HHsearch alignment for GI: peg_887 and conserved domain: pfam02283

>pfam02283 CobU Cobinamide kinase / cobinamide phosphate guanyltransferase. This family is composed of a group of bifunctional cobalamin biosynthesis enzymes which display cobinamide kinase and cobinamide phosphate guanyltransferase activity. The crystal structure of the enzyme reveals the molecule to be a trimer with a propeller-like shape.
Probab=96.00  E-value=0.0043  Score=39.85  Aligned_cols=40  Identities=35%  Similarity=0.477  Sum_probs=31.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCEEEECCHHHHHCCCCCCCCCCCHHHHC
Q ss_conf             999879873344999999988198797500442116822242346768742
Q 537021.9.peg.8   13 IFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQ   63 (133)
Q Consensus        13 i~I~GpTasGKT~lai~LA~~~~~~IIs~DS~QvYk~l~IgTaKps~~e~~   63 (133)
T Consensus         1 iLVtGG~rSGKS~~AE~la~~~~~~~-----------~YiAT~~~~D~Em~   40 (166)
T pfam02283         1 ILVTGGARSGKSRFAERLALASGGPV-----------VYIATAQAFDDEMA   40 (166)
T ss_pred             CEEECCCCCCHHHHHHHHHHHCCCCE-----------EEEECCCCCCHHHH
T ss_conf             98868877338999999998559981-----------99976988888999