RPSBLAST alignment for GI: peg_887 and conserved domain: KOG1384

>gnl|CDD|36598 KOG1384, KOG1384, KOG1384, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]. Length = 348
 Score = 90.0 bits (223), Expect = 2e-19
 Identities = 35/92 (38%), Positives = 57/92 (61%)

Query: 4  MFLSTHTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQ 63
          M   +  K + I G T +GKS  AV+LA +F G IIN+D MQVY  L I+T++ + Q+ +
Sbjct: 1  MKKKSKDKVVVIMGATGAGKSRLAVDLATRFPGEIINSDKMQVYKGLDIVTNKITLQERK 60

Query: 64 SIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEV 95
           +PH+L G++  +  Y+ G++   A + I E+
Sbjct: 61 GVPHHLLGHLHPEAEYTAGEFEDDASRAIEEI 92