RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.888_1 (217 letters) >gnl|CDD|30672 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]. Length = 308 Score = 194 bits (495), Expect = 1e-50 Identities = 87/217 (40%), Positives = 125/217 (57%), Gaps = 2/217 (0%) Query: 1 MLSKKLQRYKKRF-LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59 + R LPI+VGGTGLY +AL LS++PE +R ++ +L + G+ LH Sbjct: 80 DALAAIDDILARGKLPILVGGTGLYLKALLEGLSLLPEADPEVRRRLEAELAELGNDALH 139 Query: 60 DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119 EL +D A +IHP+D QRI RALE+ ++G+ I E K++ P + I + Sbjct: 140 AELKKIDPEAAAKIHPNDPQRIIRALEVYYLTGKPISELQKRSRPILEPYD-ILIIALAA 198 Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179 +R L ERI RR MLE G I+E+++L L LDLP M+AIG ++I+A L G I+ +E Sbjct: 199 DREVLYERINRRVDAMLEQGLIEEVKALYARGLHLDLPAMQAIGYKEILAYLDGGISLEE 258 Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216 ++R AT +YAKRQ TW +Q W+ S D L Sbjct: 259 AIERIKTATRQYAKRQLTWFRNQLGVHWLDSESPDTL 295 >gnl|CDD|145065 pfam01715, IPPT, IPP transferase. This is a family of IPP transferases EC:2.5.1.8 also known as tRNA delta(2)-isopentenylpyrophosphate transferase. These enzymes modify both cytoplasmic and mitochondrial tRNAs at A(37) to give isopentenyl A(37). Length = 253 Score = 190 bits (485), Expect = 3e-49 Identities = 83/197 (42%), Positives = 121/197 (61%), Gaps = 2/197 (1%) Query: 14 LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73 +P++VGGTGLYF+AL LS P +R K+ E+L++ G+ LH EL+S+D A +I Sbjct: 58 IPLLVGGTGLYFKALLDGLSDTPSADPKVRAKLEEQLEELGNDYLHAELASVDPEAAAKI 117 Query: 74 HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133 HP+DG+RI RALE+ +G+ I EF K+ N +I + +R L ERI RR Sbjct: 118 HPNDGRRIVRALEVFYATGKPISEFQKEQKNALPY--DIVQIGLARDREVLHERIARRVD 175 Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193 MLESG ++E+++L L+ DLP ++AIG ++ + L GE +E ++R I AT +YAK Sbjct: 176 DMLESGLVEEVKALYAQGLNEDLPSIRAIGYKEFLLYLDGECTLEEAIERIIKATRQYAK 235 Query: 194 RQKTWLCHQFQADWIRI 210 RQ TW Q W+ I Sbjct: 236 RQMTWFRKDSQVHWLDI 252 >gnl|CDD|36598 KOG1384, KOG1384, KOG1384, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]. Length = 348 Score = 42.6 bits (100), Expect = 9e-05 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 13/93 (13%) Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLS-LDLPIMKAIGVRDIIALLKGEI--- 175 +++ L ER+ +R MLESG ++E+R S I KAIGV + + Sbjct: 147 DQAVLFERLDKRVDDMLESGLLEELRDFYDPYNSSYRSGIRKAIGVPEFDGFKEFYPWLT 206 Query: 176 ---------NYDETLQRGIIATNKYAKRQKTWL 199 ++ ++ T + AKRQK + Sbjct: 207 DKWDLARKELLEKAIEAIKENTRRLAKRQKRKI 239 Score = 27.2 bits (60), Expect = 3.7 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Query: 3 SKKLQRYKKRFLPIIVGGTGLYFRAL 28 +++ K LPI+VGG+ Y +AL Sbjct: 89 IEEIHSRGK--LPIVVGGSNSYLQAL 112 >gnl|CDD|37150 KOG1939, KOG1939, KOG1939, Oxoprolinase [Amino acid transport and metabolism]. Length = 1247 Score = 28.8 bits (64), Expect = 1.1 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 7/69 (10%) Query: 35 MPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQS 94 M I +RE LK+ G +L LS+ D DG I + I G++ Sbjct: 945 MKHIQNNAELAVREMLKKVGRRVLEKTLSAED-------FMDDGSPIKLKVTIDPEKGEA 997 Query: 95 IIEFWKQAP 103 I +F P Sbjct: 998 IFDFTGTGP 1006 >gnl|CDD|132854 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like phospholipase of bacteria. Patatin is a storage protein of the potato tuber that shows Phospholipase A2 activity (PLA2; EC 3.1.1.4). Patatin catalyzes the nonspecific hydrolysis of phospholipids, glycolipids, sulfolipids, and mono- and diacylglycerols, thereby showing lipid acyl hydrolase activity. The active site includes an oxyanion hole with a conserved GGxR motif; it is found in almost all the members of this family. The catalytic dyad is formed by a serine and an aspartate. Patatin belongs to the alpha-beta hydrolase family which is identified by a characteristic nucleophile elbow with a consensus sequence of Sm-X-Nu-Sm (Sm = small residue, X = any residue and Nu = nucleophile). Members of this family have been found also in vertebrates. This family includes subfamily of PNPLA8 (iPLA2-gamma) and PNPLA9 (iPLA2-beta) like phospholipases from human as well as the Pat17 isozyme from Solanum cardiophyllum. Length = 329 Score = 28.5 bits (64), Expect = 1.6 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Query: 24 YFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71 Y R PE+ A E + EKL++ G + D LD IV R Sbjct: 282 YLRIQPELEDADPEMDDASPENL-EKLREVGQALAEDHKDQLDEIVDR 328 >gnl|CDD|112154 pfam03326, Herpes_TAF50, Herpesvirus transcription activation factor (transactivator). This family includes EBV BRLF1 and similar ORF 50 proteins from other herpesviruses. Length = 500 Score = 28.2 bits (63), Expect = 1.6 Identities = 16/85 (18%), Positives = 31/85 (36%), Gaps = 3/85 (3%) Query: 21 TGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQR 80 TG++ ++ Q ++PE + E L L + L + + I+ + P Q Sbjct: 157 TGIFSGLVSQQSFVLPEP--LLLEISEPGLLAASDADLSELLQNPEEILETRASPLS-QF 213 Query: 81 IARALEIKLVSGQSIIEFWKQAPNP 105 L QS ++ + P Sbjct: 214 HGFTPHPSLPQPQSPLKPSPSSARP 238 >gnl|CDD|146078 pfam03264, Cytochrom_NNT, NapC/NirT cytochrome c family, N-terminal region. Within the NapC/NirT family of cytochrome c proteins, some members, such as NapC and NirT, bind four haem groups, while others, such as TorC, bind five haems. This family aligns the common N-terminal region that contains four haem-binding C-X(2)-CH motifs. Length = 174 Score = 28.0 bits (63), Expect = 1.9 Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 7/53 (13%) Query: 160 KAIGVRDIIALLKGEINYDETLQ--RGIIATNKYAKRQKTWL-----CHQFQA 205 KA +++ A L G I+ E + R +A +A+ + CH F + Sbjct: 84 KAQASKEVYAELTGTIDTPEKFEAHRLEMAERVWARMKANDSRECRNCHSFDS 136 >gnl|CDD|147180 pfam04882, Peroxin-3, Peroxin-3. Peroxin-3 is a peroxisomal protein. It is thought to be involve in membrane vesicle assembly prior to the translocation of matrix proteins. Length = 393 Score = 27.3 bits (61), Expect = 3.1 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKG 173 KE+I+RRF Q + + +L+ L PI++A+ V +I L+ Sbjct: 50 KEQIKRRFEQ-TQRDCNYTVLALLPT---LSEPILEALDVEEITEKLQQ 94 >gnl|CDD|33325 COG3522, COG3522, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 446 Score = 27.1 bits (60), Expect = 3.7 Identities = 23/104 (22%), Positives = 39/104 (37%), Gaps = 6/104 (5%) Query: 50 LKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPL 109 L Y L L + R + RA+ I L W + Sbjct: 288 LPVYDHDDLTASFKPLFDALRRLLSTV---LEPRAVAIPLEERA--YGVWVARLHDPKLR 342 Query: 110 ESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLS 153 +SA ++ + E++RR+F Q + GA ++IR L+ + L Sbjct: 343 DSASFVLAVRADMPA-EQLRRQFPQQTKVGAPEKIRELVNVQLP 385 >gnl|CDD|30460 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]. Length = 324 Score = 26.4 bits (58), Expect = 5.8 Identities = 11/73 (15%), Positives = 27/73 (36%), Gaps = 4/73 (5%) Query: 77 DGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQML 136 D + AL+ ++G ++ F ++ PL +I+ P + + R ++ Sbjct: 239 DEDALLAALDSGKIAGAALDVFEEEPLPADSPLWDLPNVILTPHIGGSTDEAQERVAEI- 297 Query: 137 ESGAIDEIRSLMK 149 + I + Sbjct: 298 ---VAENIVRYLA 307 >gnl|CDD|35466 KOG0245, KOG0245, KOG0245, Kinesin-like protein [Cytoskeleton]. Length = 1221 Score = 26.5 bits (58), Expect = 5.9 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 5/34 (14%) Query: 167 IIALLKGEINYDETLQRGIIATNKYAKRQKTWLC 200 I AL +INY+ETL +T +YA R K + Sbjct: 322 IAALSPADINYEETL-----STLRYADRAKQIVN 350 >gnl|CDD|73161 cd03714, RT_DIRS1, RT_DIRS1: Reverse transcriptases (RTs) occurring in the DIRS1 group of retransposons. Members of the subfamily include the Dictyostelium DIRS-1, Volvox carteri kangaroo, and Panagrellus redivivus PAT elements. These elements differ from LTR and conventional non-LTR retrotransposons. They contain split direct repeat (SDR) termini, and have been proposed to integrate via double-stranded closed-circle DNA intermediates assisted by an encoded recombinase which is similar to gamma-site-specific integrase.. Length = 119 Score = 26.4 bits (58), Expect = 6.2 Identities = 13/49 (26%), Positives = 20/49 (40%) Query: 11 KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59 + L G F+AL LS+ P + T + E + L+ G I Sbjct: 17 RDLLGFAWQGETYQFKALPFGLSLAPRVFTKVVEALLAPLRLLGVRIFS 65 >gnl|CDD|132752 cd06954, NR_LBD_LXR, The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors. The ligand binding domain of Liver X receptors: Liver X receptors (LXRs) belong to a family of nuclear receptors of ligand-activated transcription factors. LXRs operate as cholesterol sensors which protect from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. Upon ligand binding a conformational change leads to recruitment of co-factors, which stimulates expression of target genes. Among the LXR target genes are several genes involved in cholesterol efflux from peripheral tissues such as the ATP-binding-cassette transporters ABCA1, ABCG1 and ApoE. There are two LXR isoforms in mammals, LXRalpha and LXRbeta. LXRalpha is expressed mainly in the liver, intestine, kidney, spleen, and adipose tissue, whereas LXRbeta is ubiquitously expressed at lower level. Both LXRalpha and LXRbeta function as heterodimers with the retinoid X receptor (RX R) which may be activated by either LXR ligands or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. LXR has typical NR modular structure with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and the ligand binding domain (LBD) at the C-terminal. Length = 236 Score = 26.3 bits (58), Expect = 7.8 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query: 79 QRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118 QR A E+ ++S Q I++F KQ P F+ L +I +L Sbjct: 43 QRFAHFTELAILSVQEIVDFAKQLPG-FLTLTREDQIALL 81 >gnl|CDD|163621 cd07378, MPP_ACP5, Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain. Acid phosphatase 5 (ACP5) removes the mannose 6-phosphate recognition marker from lysosomal proteins. The exact site of dephosphorylation is not clear. Evidence suggests dephosphorylation may take place in a prelysosomal compartment as well as in the lysosome. ACP5 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 277 Score = 25.7 bits (57), Expect = 9.0 Identities = 10/36 (27%), Positives = 12/36 (33%), Gaps = 3/36 (8%) Query: 176 NYDETLQRGIIATNKYAKRQKTWLCHQFQ---ADWI 208 N D+ K A+ Q WL ADW Sbjct: 134 NSDDIASPYGPPNGKLAEEQLAWLEKTLAASTADWK 169 >gnl|CDD|33261 COG3458, COG3458, Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 321 Score = 25.7 bits (56), Expect = 9.6 Identities = 10/50 (20%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDII---ALLKGEI 175 R ++ G DEI++ K + + + + + DI+ A +K + Sbjct: 213 FPRAIELATEGPYDEIQTYFKRHDPKEAEVFETLSYFDIVNLAARIKVPV 262 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.139 0.399 Gapped Lambda K H 0.267 0.0733 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,720,701 Number of extensions: 143042 Number of successful extensions: 479 Number of sequences better than 10.0: 1 Number of HSP's gapped: 476 Number of HSP's successfully gapped: 31 Length of query: 217 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 127 Effective length of database: 4,318,927 Effective search space: 548503729 Effective search space used: 548503729 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 55 (25.0 bits)