Query 537021.9.peg.905_1 Match_columns 56 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 04:53:18 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_905.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG0892 consensus 72.5 3.8 9.8E-05 22.3 3.0 31 3-33 2675-2705(2806) 2 KOG3133 consensus 66.2 9.5 0.00024 20.1 3.9 38 15-52 143-183 (267) 3 KOG1606 consensus 58.1 19 0.00048 18.5 5.2 52 1-53 148-206 (296) 4 pfam04614 Pex19 Pex19 protein 52.9 23 0.00059 18.0 4.1 44 6-49 113-158 (245) 5 cd05170 PIKKc_SMG1 Suppressor 37.5 17 0.00042 18.8 1.3 31 3-33 259-289 (307) 6 cd05169 PIKKc_TOR TOR (Target 37.4 20 0.00052 18.3 1.7 30 3-32 232-261 (280) 7 pfam01680 SOR_SNZ SOR/SNZ fami 30.1 55 0.0014 15.9 4.5 52 1-53 142-200 (209) 8 TIGR01108 oadA oxaloacetate de 27.0 34 0.00086 17.1 1.4 15 33-47 265-279 (616) 9 cd05163 TRRAP TRansformation/t 23.8 40 0.001 16.7 1.3 31 3-33 205-235 (253) 10 PHA02152 hypothetical protein 22.5 56 0.0014 15.9 1.8 27 27-53 67-93 (96) 11 pfam00846 Hanta_nucleocap Hant 22.4 78 0.002 15.1 3.0 35 21-55 339-374 (428) 12 COG3643 Glutamate formiminotra 20.5 60 0.0015 15.7 1.7 19 22-40 136-154 (302) No 1 >KOG0892 consensus Probab=72.55 E-value=3.8 Score=22.25 Aligned_cols=31 Identities=32% Similarity=0.616 Sum_probs=27.8 Q ss_pred EECCCCCCCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 7712232431389999999999998599999 Q 537021.9.peg.9 3 IIDGLGVHGVDVEYVKHIESIMASLRKEEYE 33 (56) Q Consensus 3 iidglgvhgvdveyvkhiesimaslrkeeye 33 (56) |+||.|+.||+--+-+--|-.|+-||+++-. T Consensus 2675 iVdgmGItGveGvFrRccE~t~~vlR~~~~~ 2705 (2806) T KOG0892 2675 IVDGMGITGVEGVFRRCCEFTLEVLRREKES 2705 (2806) T ss_pred HCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH T ss_conf 0155576671689999999999999860588 No 2 >KOG3133 consensus Probab=66.20 E-value=9.5 Score=20.11 Aligned_cols=38 Identities=37% Similarity=0.572 Sum_probs=28.8 Q ss_pred HHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHH-HHHHC Q ss_conf 99999999999985999--9999999998999975-55521 Q 537021.9.peg.9 15 EYVKHIESIMASLRKEE--YEKMKEVRKSYNSFLK-HKASL 52 (56) Q Consensus 15 eyvkhiesimaslrkee--yekmkevrksynsflk-hkasl 52 (56) ..---+++||-+|--.| |+-|||.+-.|--||+ |+++| T Consensus 143 ~le~~m~~iMqqllSKEILyeplKEl~~~YPkwLeen~e~l 183 (267) T KOG3133 143 DLEPIMESIMQQLLSKEILYEPLKELGANYPKWLEENGESL 183 (267) T ss_pred CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC T ss_conf 37999999999998887740169999987359998553556 No 3 >KOG1606 consensus Probab=58.11 E-value=19 Score=18.46 Aligned_cols=52 Identities=35% Similarity=0.482 Sum_probs=37.5 Q ss_pred CEEECCCCCCCCHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 96771223243138999999999999859-------999999999998999975555216 Q 537021.9.peg.9 1 MIIIDGLGVHGVDVEYVKHIESIMASLRK-------EEYEKMKEVRKSYNSFLKHKASLG 53 (56) Q Consensus 1 miiidglgvhgvdveyvkhiesimaslrk-------eeyekmkevrksynsflkhkaslg 53 (56) ||-+.|-.-.|--+|-|||+.|++..+|. |-|..-||.+-.|. .++...++| T Consensus 148 MIRtkGeagTG~v~EaVkhvr~i~geir~~~~m~~dev~t~Ak~i~aP~d-Lv~~t~q~G 206 (296) T KOG1606 148 MIRTKGEAGTGDVSEAVKHVRSINGEIRVLKNMDDDEVFTFAKEIAAPYD-LVKQTKQLG 206 (296) T ss_pred HHEECCCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCHH-HHHHHHHCC T ss_conf 40204646777499999999998899999872887899999998647089-999999708 No 4 >pfam04614 Pex19 Pex19 protein family. Probab=52.94 E-value=23 Score=17.98 Aligned_cols=44 Identities=32% Similarity=0.551 Sum_probs=34.3 Q ss_pred CCCCCCCHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHH Q ss_conf 22324313899999999999985999--999999999899997555 Q 537021.9.peg.9 6 GLGVHGVDVEYVKHIESIMASLRKEE--YEKMKEVRKSYNSFLKHK 49 (56) Q Consensus 6 glgvhgvdveyvkhiesimaslrkee--yekmkevrksynsflkhk 49 (56) |.|--|-+-..-+-+.++|-.|--.| |+-|||....|-.+|... T Consensus 113 ~~g~~~~~~~~~~~l~~mm~qL~sKevLYepmKel~~kyp~wL~~n 158 (245) T pfam04614 113 GDGGGGGDGDMSKLLQGMMEQLSSKEVLYEPLKELNDKYPKWLEEN 158 (245) T ss_pred CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHC T ss_conf 8878886110999999999997237663400999987661988847 No 5 >cd05170 PIKKc_SMG1 Suppressor of morphogenetic effect on genitalia-1 (SMG-1), catalytic domain; The SMG-1 catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. SMG-1 is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). In addition to its catalytic domain, SMG-1 contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. SMG-1 plays a critical role in the mRNA surveillance mechanism known as non-sense mediated mRNA decay (NMD). NMD protects the cells from the accumulation of aberrant mRNAs with premature termination codons (PTCs) generated by geno Probab=37.46 E-value=17 Score=18.77 Aligned_cols=31 Identities=23% Similarity=0.380 Sum_probs=21.6 Q ss_pred EECCCCCCCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 7712232431389999999999998599999 Q 537021.9.peg.9 3 IIDGLGVHGVDVEYVKHIESIMASLRKEEYE 33 (56) Q Consensus 3 iidglgvhgvdveyvkhiesimaslrkeeye 33 (56) ++|++|+.|++-.+-...|.+|..||+.+.. T Consensus 259 iv~~~g~~g~eG~fr~~~~~~l~~Lr~~~~~ 289 (307) T cd05170 259 IETALGLTGVEGVFRLSCEQVLHIMRRGRET 289 (307) T ss_pred HHHHHCCCCCCCHHHHHHHHHHHHHHCCHHH T ss_conf 9998476577740799999999999729688 No 6 >cd05169 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; The TOR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TOR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). TOR contains a rapamycin binding domain, a catalytic domain, and a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. It is also called FRAP (FK506 binding protein 12-rapamycin associated protein). TOR is a central component of the eukaryotic growth regulatory network. It controls the expression of many genes transcribed by all three RNA polymerases. It associates with Probab=37.41 E-value=20 Score=18.28 Aligned_cols=30 Identities=27% Similarity=0.586 Sum_probs=24.6 Q ss_pred EECCCCCCCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 771223243138999999999999859999 Q 537021.9.peg.9 3 IIDGLGVHGVDVEYVKHIESIMASLRKEEY 32 (56) Q Consensus 3 iidglgvhgvdveyvkhiesimaslrkeey 32 (56) ++|++|+.|++--+..-.+++|..||+... T Consensus 232 ~v~~mg~~g~eG~F~~~~~~~l~~Lr~~~~ 261 (280) T cd05169 232 LVNALGVSGIEGTFRTTCEDVMNVLRENKE 261 (280) T ss_pred HHHHHCCCCCCCHHHHHHHHHHHHHHHCHH T ss_conf 999848878760589999999999984968 No 7 >pfam01680 SOR_SNZ SOR/SNZ family. Members of this family are enzymes involved in a new pathway of pyridoxine/pyridoxal 5-phosphate biosynthesis. This family was formerly known as UPF0019. Probab=30.07 E-value=55 Score=15.90 Aligned_cols=52 Identities=35% Similarity=0.510 Sum_probs=34.4 Q ss_pred CEEECCCCCCCCHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 96771223243138999999999999859-------999999999998999975555216 Q 537021.9.peg.9 1 MIIIDGLGVHGVDVEYVKHIESIMASLRK-------EEYEKMKEVRKSYNSFLKHKASLG 53 (56) Q Consensus 1 miiidglgvhgvdveyvkhiesimaslrk-------eeyekmkevrksynsflkhkaslg 53 (56) ||-..|-.-.|--+|-|+|+..|+...|. |-|..-|+.+-+|. .++.-+.+| T Consensus 142 MIRTKGEaGTGnVvEAVrH~R~i~~eI~~l~~~~~~el~~~Ak~~~ap~e-Lv~~~~~~g 200 (209) T pfam01680 142 MIRTKGEAGTGNVVEAVRHMRLMNGEIRRLQNMSEDELYTVAKELAAPYE-LVKQVAELG 200 (209) T ss_pred HCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCHH-HHHHHHHHC T ss_conf 13467878987599999999999999999976999999999998798999-999999978 No 8 >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea . The oxaloacetate decarboxylase Na+ pump is the paradigm of the family of Na+ transport decarboxylases that present in bacteria and archaea. It a multi subunit enzyme consisting of a peripheral alpha-subunit and integral membrane subunits beta and gamma. The energy released by the decarboxylation reaction of oxaloacetate is coupled to Na+ ion pumping across the membrane.; GO: 0008948 oxaloacetate decarboxylase activity, 0006814 sodium ion transport. Probab=26.98 E-value=34 Score=17.07 Aligned_cols=15 Identities=40% Similarity=0.857 Sum_probs=11.9 Q ss_pred HHHHHHHHHHHHHHH Q ss_conf 999999998999975 Q 537021.9.peg.9 33 EKMKEVRKSYNSFLK 47 (56) Q Consensus 33 ekmkevrksynsflk 47 (56) +-+++|||-|..||. T Consensus 265 ~YFr~VRkKY~~fle 279 (616) T TIGR01108 265 DYFRKVRKKYSQFLE 279 (616) T ss_pred HHHHHHHHHHHHHCC T ss_conf 999999999988607 No 9 >cd05163 TRRAP TRansformation/tRanscription domain-Associated Protein (TRRAP), pseudokinase domain; The TRRAP catalytic domain is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TRRAP shows some similarity to members of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily in that it contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain and has a large molecular weight. Unlike PIKK proteins, however, it contains an inactive PI3K-like pseudokinase domain, which lacks the conserved residues necessary for ATP binding and catalytic activity. TRRAP also contains many motifs that may be critical for protein-protein interactions. TRRAP is a common component of many histone acetyltransferase (HAT) complexes, and is responsible for the recruitment of these complexes to chromatin during transcription, replicat Probab=23.81 E-value=40 Score=16.65 Aligned_cols=31 Identities=19% Similarity=0.311 Sum_probs=26.4 Q ss_pred EECCCCCCCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 7712232431389999999999998599999 Q 537021.9.peg.9 3 IIDGLGVHGVDVEYVKHIESIMASLRKEEYE 33 (56) Q Consensus 3 iidglgvhgvdveyvkhiesimaslrkeeye 33 (56) |++++|+-|++-.+-...+++|..||+.+.- T Consensus 205 i~~~lg~~g~~G~f~~~~~~~~~~Lr~~~~~ 235 (253) T cd05163 205 IQHLIGPIGLEGILTSSMMAIARCLTEPEFD 235 (253) T ss_pred HHHHHCCCCCCCHHHHHHHHHHHHHHCCHHH T ss_conf 9998577677732899999999999739788 No 10 >PHA02152 hypothetical protein Probab=22.54 E-value=56 Score=15.87 Aligned_cols=27 Identities=26% Similarity=0.330 Sum_probs=17.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 859999999999998999975555216 Q 537021.9.peg.9 27 LRKEEYEKMKEVRKSYNSFLKHKASLG 53 (56) Q Consensus 27 lrkeeyekmkevrksynsflkhkaslg 53 (56) .-++.|+||+..----.+|---.-|+. T Consensus 67 ~~~~dy~km~~ii~li~sfd~~~fs~~ 93 (96) T PHA02152 67 YFKEDYDKMATIVGLIKTFDPYEFSME 93 (96) T ss_pred HHHHHHHHHHHHHHHHHHCCHHHHHHH T ss_conf 677658999888754230587772134 No 11 >pfam00846 Hanta_nucleocap Hantavirus nucleocapsid protein. Probab=22.36 E-value=78 Score=15.09 Aligned_cols=35 Identities=37% Similarity=0.554 Sum_probs=26.4 Q ss_pred HHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 99999985-999999999999899997555521642 Q 537021.9.peg.9 21 ESIMASLR-KEEYEKMKEVRKSYNSFLKHKASLGIK 55 (56) Q Consensus 21 esimaslr-keeyekmkevrksynsflkhkaslgik 55 (56) ..||||-. -..-||+|.--.-|.|+|....|.||. T Consensus 339 ntImASktvGTaEEKlkkKSsFYQSYlRRTQSMGiq 374 (428) T pfam00846 339 NTIMASKTVGTAEEKLKKKSAFYQSYLRRTQSMGIQ 374 (428) T ss_pred HHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 778775134608888864518999999887751344 No 12 >COG3643 Glutamate formiminotransferase [Amino acid transport and metabolism] Probab=20.54 E-value=60 Score=15.71 Aligned_cols=19 Identities=42% Similarity=0.592 Sum_probs=15.2 Q ss_pred HHHHHHHHHHHHHHHHHHH Q ss_conf 9999985999999999999 Q 537021.9.peg.9 22 SIMASLRKEEYEKMKEVRK 40 (56) Q Consensus 22 simaslrkeeyekmkevrk 40 (56) +-.|+.||.+||.|+|--| T Consensus 136 ~~La~IRkgqyE~l~ekik 154 (302) T COG3643 136 QNLADIRKGQYEGLKEKIK 154 (302) T ss_pred CCHHHHHHHHHHHHHHHHC T ss_conf 4477775223666788742 Done!