BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 537021.9.peg.905_1 (56 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done >gi|156144451|gb|ABU52896.1| glycoprotein B [Pan troglodytes rhadinovirus 2] gi|157061820|gb|ABV03809.1| glycoprotein B [Pan troglodytes rhadinovirus 2] Length = 338 Score = 34.6 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Query: 11 GVDVEYVKHIESIMASLRKEEYEKMKEVRKSYNSFLKHKASLGIK 55 G+D E +K+I + M L++EE++++KE RK+ + ++ +AS G++ Sbjct: 274 GMDREQIKNILAGMHQLQQEEHQRLKEQRKTTPTLIQ-RASQGLR 317 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.318 0.136 0.365 Lambda K H 0.267 0.0464 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 589,685,921 Number of Sequences: 13984884 Number of extensions: 20538667 Number of successful extensions: 103402 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 103402 Number of HSP's gapped (non-prelim): 2 length of query: 56 length of database: 4,792,584,752 effective HSP length: 29 effective length of query: 27 effective length of database: 4,387,023,116 effective search space: 118449624132 effective search space used: 118449624132 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 76 (33.7 bits)