RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.905_1 (56 letters) >gnl|CDD|119418 cd00892, PIKKc_ATR, ATR (Ataxia telangiectasia and Rad3-related), catalytic domain; The ATR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATR is also referred to as Mei-41 (Drosophila), Esr1/Mec1p (Saccharomyces cerevisiae), Rad3 (Schizosaccharomyces pombe), and FRAP-related protein (human). ATR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATR contains a UME domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. Together with its downstream effector kinase, Chk1, ATR plays a central role in regulating the replication checkpoint. ATR stabilizes replication forks by promoting the association of DNA polymerases with the fork. Preventing fork collapse is essential in preserving genomic integrity. ATR plays a role in normal cell growth and in response to DNA damage.. Length = 237 Score = 28.0 bits (63), Expect = 0.56 Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 3 IIDGLGVHGVDVEYVKHIESIMASLRKEEYEKM 35 ++D +GV GV+ + K E + LR + M Sbjct: 189 MVDAMGVLGVEGLFRKSCEVTLRLLRSNKETLM 221 >gnl|CDD|36110 KOG0892, KOG0892, KOG0892, Protein kinase ATM/Tel1, involved in telomere length regulation and DNA repair [Signal transduction mechanisms, Chromatin structure and dynamics, Replication, recombination and repair, Cell cycle control, cell division, chromosome partitioning]. Length = 2806 Score = 27.7 bits (61), Expect = 0.66 Identities = 10/29 (34%), Positives = 19/29 (65%) Query: 3 IIDGLGVHGVDVEYVKHIESIMASLRKEE 31 I+DG+G+ GV+ + + E + LR+E+ Sbjct: 2675 IVDGMGITGVEGVFRRCCEFTLEVLRREK 2703 >gnl|CDD|38343 KOG3133, KOG3133, KOG3133, 40 kDa farnesylated protein associated with peroxisomes [Intracellular trafficking, secretion, and vesicular transport]. Length = 267 Score = 27.7 bits (61), Expect = 0.70 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Query: 20 IESIMASLRKEE--YEKMKEVRKSYNSFLK-HKASL 52 +ESIM L +E YE +KE+ +Y +L+ + SL Sbjct: 148 MESIMQQLLSKEILYEPLKELGANYPKWLEENGESL 183 >gnl|CDD|119431 cd05171, PIKKc_ATM, Ataxia telangiectasia mutated (ATM), catalytic domain; The ATM catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATM is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATM contains a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. ATM is critical in the response to DNA double strand breaks (DSBs) caused by radiation. It is activated at the site of a DSB and phosphorylates key substrates that trigger pathways that regulate DNA repair and cell cycle checkpoints at the G1/S, S phase, and G2/M transition. Patients with the human genetic disorder Ataxia telangiectasia (A-T), caused by truncating mutations in ATM, show genome instability, increased cancer risk, immunodeficiency, compromised mobility, and neurodegeneration. A-T displays clinical heterogeneity, which is correlated to the degree of retained ATM activity.. Length = 279 Score = 26.4 bits (59), Expect = 2.0 Identities = 9/28 (32%), Positives = 16/28 (57%) Query: 3 IIDGLGVHGVDVEYVKHIESIMASLRKE 30 I+DG+G+ GV+ + + E + LR Sbjct: 231 IVDGMGITGVEGVFRRCCEKTLEVLRDN 258 >gnl|CDD|31465 COG1274, PckA, Phosphoenolpyruvate carboxykinase (GTP) [Energy production and conversion]. Length = 608 Score = 26.0 bits (57), Expect = 2.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Query: 7 LGVHGVDVEYVKHIESIMASLRKEEYEKM 35 LGV D YV H IM + KE EK+ Sbjct: 143 LGVELTDSPYVVHSMRIMTRMGKEVLEKL 171 >gnl|CDD|36108 KOG0890, KOG0890, KOG0890, Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms, Chromatin structure and dynamics, Replication, recombination and repair, Cell cycle control, cell division, chromosome partitioning]. Length = 2382 Score = 24.6 bits (53), Expect = 7.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Query: 3 IIDGLGVHGVDVEYVKHIESIMASLRKEE 31 +ID +G G++ + K E + LRK Sbjct: 2269 MIDAMGPLGLEGSFRKVCEITLRLLRKNR 2297 >gnl|CDD|109884 pfam00846, Hanta_nucleocap, Hantavirus nucleocapsid protein. Length = 428 Score = 24.1 bits (52), Expect = 8.0 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Query: 22 SIMASLR-KEEYEKMKEVRKSYNSFLKHKASLGIKV 56 +IMAS EK+K+ Y S+L+ S+GI++ Sbjct: 340 TIMASKTVGTAEEKLKKKSAFYQSYLRRTQSMGIQL 375 >gnl|CDD|34637 COG5032, TEL1, Phosphatidylinositol kinase and protein kinases of the PI-3 kinase family [Signal transduction mechanisms / Cell division and chromosome partitioning / Chromatin structure and dynamics / DNA replication, recombination, and repair / Intracellular trafficking and secretion]. Length = 2105 Score = 24.3 bits (52), Expect = 8.5 Identities = 9/29 (31%), Positives = 17/29 (58%) Query: 3 IIDGLGVHGVDVEYVKHIESIMASLRKEE 31 I++ +GV GV+ + + E+ +LRK Sbjct: 1993 IVEAMGVSGVEGSFRELCETAFRALRKNA 2021 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.136 0.365 Gapped Lambda K H 0.267 0.0806 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 644,408 Number of extensions: 23666 Number of successful extensions: 137 Number of sequences better than 10.0: 1 Number of HSP's gapped: 137 Number of HSP's successfully gapped: 14 Length of query: 56 Length of database: 6,263,737 Length adjustment: 28 Effective length of query: 28 Effective length of database: 5,658,685 Effective search space: 158443180 Effective search space used: 158443180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.3 bits)