RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= 537021.9.peg.905_1 (56 letters) >d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Length = 532 Score = 26.2 bits (56), Expect = 0.82 Identities = 10/41 (24%), Positives = 18/41 (43%) Query: 8 GVHGVDVEYVKHIESIMASLRKEEYEKMKEVRKSYNSFLKH 48 G HG ++ V + +EE K V K + +F ++ Sbjct: 445 GDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARN 485 >d1rcwa_ a.132.1.4 (A:) Hypothetical protein CT610 {Chlamydia trachomatis [TaxId: 813]} Length = 213 Score = 23.3 bits (49), Expect = 5.0 Identities = 6/26 (23%), Positives = 16/26 (61%) Query: 12 VDVEYVKHIESIMASLRKEEYEKMKE 37 DV + + ++++ L K++ +K+ E Sbjct: 171 ADVRHAREEKALIEMLLKDDADKVLE 196 >d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Length = 254 Score = 23.6 bits (51), Expect = 5.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Query: 1 MIIIDGLGVHGVDVEYVKHIESIMASLRK 29 M+ G G VE V+H+ + A +RK Sbjct: 128 MLRTKGEPGTGNIVEAVRHMRKVNAQIRK 156 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.136 0.365 Gapped Lambda K H 0.267 0.0397 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 207,555 Number of extensions: 7042 Number of successful extensions: 36 Number of sequences better than 10.0: 1 Number of HSP's gapped: 36 Number of HSP's successfully gapped: 10 Length of query: 56 Length of database: 2,407,596 Length adjustment: 27 Effective length of query: 29 Effective length of database: 2,036,886 Effective search space: 59069694 Effective search space used: 59069694 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.8 bits)