BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.905_1 (56 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.905_1 Length = 56 Score = 110 bits (275), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 56/56 (100%), Positives = 56/56 (100%) Query: 1 MIIIDGLGVHGVDVEYVKHIESIMASLRKEEYEKMKEVRKSYNSFLKHKASLGIKV 56 MIIIDGLGVHGVDVEYVKHIESIMASLRKEEYEKMKEVRKSYNSFLKHKASLGIKV Sbjct: 1 MIIIDGLGVHGVDVEYVKHIESIMASLRKEEYEKMKEVRKSYNSFLKHKASLGIKV 56 >gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Score = 22.7 bits (47), Expect = 1.3, Method: Compositional matrix adjust. Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 4 IDGLGVHGVD-VEYVKHIESIMASLRKEEYEKMKEVRKSYN 43 +D L + +Y KH +++ L K ++ +M RK++N Sbjct: 207 VDPLTPRDISFTQYEKHACALVNWLEKGKFNEMSIARKAFN 247 >gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] Length = 82 Score = 21.2 bits (43), Expect = 3.3, Method: Compositional matrix adjust. Identities = 11/35 (31%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query: 10 HGVDVE-YVKHIESIMASLRKEEYEKMKEVRKSYN 43 HG E Y+ H+ ++ L+ ++++ ++ RKSYN Sbjct: 43 HGKGYESYISHVCELIELLKNKDFDGVEIERKSYN 77 >gi|254781163|ref|YP_003065576.1| hypothetical protein CLIBASIA_05350 [Candidatus Liberibacter asiaticus str. psy62] Length = 214 Score = 21.2 bits (43), Expect = 3.8, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Query: 4 IDGLGVHGVDVE----YVKHIESIMASLRKEEYEKMKEVRKSY 42 I+G+ + D E Y+ HI+ + L+K+ KE+R + Sbjct: 167 IEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELRNDW 209 >gi|254780342|ref|YP_003064755.1| substrate-binding region of ABC-type glycine betaine transport system [Candidatus Liberibacter asiaticus str. psy62] Length = 309 Score = 20.4 bits (41), Expect = 6.0, Method: Composition-based stats. Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 40 KSYNSFLKHKASLGIKV 56 KSY K+K LG K+ Sbjct: 126 KSYQDIAKYKKELGAKI 142 >gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str. psy62] Length = 606 Score = 20.4 bits (41), Expect = 6.3, Method: Composition-based stats. Identities = 7/14 (50%), Positives = 10/14 (71%) Query: 32 YEKMKEVRKSYNSF 45 Y+++K V K Y SF Sbjct: 464 YDRLKSVSKGYASF 477 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.136 0.365 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,635 Number of Sequences: 1233 Number of extensions: 965 Number of successful extensions: 12 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of query: 56 length of database: 328,796 effective HSP length: 28 effective length of query: 28 effective length of database: 294,272 effective search space: 8239616 effective search space used: 8239616 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 31 (16.5 bits)