BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 537021.9.peg.91_1 (46 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|254780215|ref|YP_003064628.1| hypothetical protein CLIBASIA_00500 [Candidatus Liberibacter asiaticus str. psy62] gi|254039892|gb|ACT56688.1| hypothetical protein CLIBASIA_00500 [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 79.7 bits (195), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 37/40 (92%), Positives = 39/40 (97%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH LLPDFDEDRH+VIMRAHQANVLKMIAIAIKV Sbjct: 1 MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKV 40 >gi|315122342|ref|YP_004062831.1| hypothetical protein CKC_02970 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495744|gb|ADR52343.1| hypothetical protein CKC_02970 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Score = 70.1 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 32/40 (80%), Positives = 36/40 (90%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH LPDFD DRH+VIMR+H+A VLKMIAIAIKV Sbjct: 1 MLIDTHCHLALPDFDGDRHDVIMRSHKAGVLKMIAIAIKV 40 >gi|227822151|ref|YP_002826122.1| deoxyribonuclease [Sinorhizobium fredii NGR234] gi|227341151|gb|ACP25369.1| deoxyribonuclease [Sinorhizobium fredii NGR234] Length = 259 Score = 52.0 bits (123), Expect = 2e-05, Method: Composition-based stats. Identities = 22/42 (52%), Positives = 29/42 (69%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDFD +R +I RA QA V +M+ I+ +V R Sbjct: 1 MLIDTHCHLDFPDFDAERDAIIERARQAGVTQMVTISTRVKR 42 >gi|325292848|ref|YP_004278712.1| deoxyribonuclease [Agrobacterium sp. H13-3] gi|325060701|gb|ADY64392.1| putative deoxyribonuclease [Agrobacterium sp. H13-3] Length = 260 Score = 51.2 bits (121), Expect = 4e-05, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 30/42 (71%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF+ +R ++I RAH + V +M+ I+ +V R Sbjct: 1 MLIDTHCHLDFPDFEAERDDIIARAHASGVAQMVTISTRVRR 42 >gi|159184782|ref|NP_354501.2| hypothetical protein Atu1495 [Agrobacterium tumefaciens str. C58] gi|159140070|gb|AAK87286.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 260 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 30/42 (71%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF+ +R ++I RAH + V +M+ I+ +V R Sbjct: 1 MLIDTHCHLDFPDFEAERDDIIARAHASGVSQMVTISTRVRR 42 >gi|218463183|ref|ZP_03503274.1| hydrolase, TatD family protein [Rhizobium etli Kim 5] Length = 260 Score = 50.1 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 28/40 (70%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF+ +R ++ RAHQA V +M+ I+ +V Sbjct: 1 MLIDTHCHLDFADFEAERDEIVTRAHQAGVKQMVTISTRV 40 >gi|241204712|ref|YP_002975808.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240858602|gb|ACS56269.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 260 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 28/40 (70%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF+ +R ++ RAHQA V +M+ I+ +V Sbjct: 1 MLIDTHCHLDFADFEAERDEIVARAHQAGVAQMVTISTRV 40 >gi|209549395|ref|YP_002281312.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209535151|gb|ACI55086.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 260 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 28/40 (70%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF+ +R ++ RAHQA V +M+ I+ +V Sbjct: 1 MLIDTHCHLDFADFEAERDEIVSRAHQAGVKQMVTISTRV 40 >gi|150396507|ref|YP_001326974.1| TatD family hydrolase [Sinorhizobium medicae WSM419] gi|150028022|gb|ABR60139.1| hydrolase, TatD family [Sinorhizobium medicae WSM419] Length = 259 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 29/42 (69%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF+ +R +I RA +A V +M+ I+ +V R Sbjct: 1 MLIDTHCHLDFPDFEAERDAIIERAREAGVAQMVTISTRVKR 42 >gi|218510041|ref|ZP_03507919.1| hydrolase, TatD family protein [Rhizobium etli Brasil 5] Length = 173 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 28/40 (70%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF+ +R ++ RAHQA V +M+ I+ +V Sbjct: 1 MLIDTHCHLDFADFEAERDEIVTRAHQAGVKQMVTISTRV 40 >gi|254469535|ref|ZP_05082940.1| deoxyribonuclease, TatD family [Pseudovibrio sp. JE062] gi|211961370|gb|EEA96565.1| deoxyribonuclease, TatD family [Pseudovibrio sp. JE062] Length = 262 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 27/40 (67%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF E+R +I RAH+A V M+ I +V Sbjct: 3 MLVDSHCHLDFPDFAEERDQIIERAHEAGVKLMVTICTRV 42 >gi|116252219|ref|YP_768057.1| DNAse [Rhizobium leguminosarum bv. viciae 3841] gi|115256867|emb|CAK07961.1| putative DNAse [Rhizobium leguminosarum bv. viciae 3841] Length = 260 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 28/40 (70%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF+ +R ++ RAH+A V +M+ I+ +V Sbjct: 1 MLIDTHCHLDFADFEAERDEIVARAHRAGVAQMVTISTRV 40 >gi|15965353|ref|NP_385706.1| hypothetical protein SMc01193 [Sinorhizobium meliloti 1021] gi|307312728|ref|ZP_07592359.1| hydrolase, TatD family [Sinorhizobium meliloti BL225C] gi|307317212|ref|ZP_07596653.1| hydrolase, TatD family [Sinorhizobium meliloti AK83] gi|15074533|emb|CAC46179.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] gi|306897300|gb|EFN28045.1| hydrolase, TatD family [Sinorhizobium meliloti AK83] gi|306899453|gb|EFN30085.1| hydrolase, TatD family [Sinorhizobium meliloti BL225C] Length = 259 Score = 47.4 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF+ +R +I RA A V +M+ I+ +V R Sbjct: 1 MLIDTHCHLDFPDFEAERDAIIERARDAGVGQMVTISTRVKR 42 >gi|217976727|ref|YP_002360874.1| hydrolase, TatD family [Methylocella silvestris BL2] gi|217502103|gb|ACK49512.1| hydrolase, TatD family [Methylocella silvestris BL2] Length = 267 Score = 47.0 bits (110), Expect = 9e-04, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI++HCH PDF +R VI RA +A V +M+ I+ ++ R Sbjct: 1 MLIDSHCHLDFPDFAAERDAVIQRAREAGVARMVTISTRIER 42 >gi|222086009|ref|YP_002544541.1| deoxyribonuclease protein [Agrobacterium radiobacter K84] gi|221723457|gb|ACM26613.1| deoxyribonuclease protein [Agrobacterium radiobacter K84] Length = 260 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 27/40 (67%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF E+R ++ RAH+ V +M+ I+ KV Sbjct: 1 MLIDTHCHLDFADFAEERDVIVARAHEVGVKQMVTISTKV 40 >gi|163760145|ref|ZP_02167228.1| hypothetical protein HPDFL43_07784 [Hoeflea phototrophica DFL-43] gi|162282544|gb|EDQ32832.1| hypothetical protein HPDFL43_07784 [Hoeflea phototrophica DFL-43] Length = 260 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 27/40 (67%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++HCH DFD +R +I RAH + V +M+ I+ +V Sbjct: 1 MLIDSHCHLDFADFDAERDELIARAHASGVKQMVTISTRV 40 >gi|328543901|ref|YP_004304010.1| Hydrolase, TatD family [Polymorphum gilvum SL003B-26A1] gi|326413645|gb|ADZ70708.1| Hydrolase, TatD family [Polymorphum gilvum SL003B-26A1] Length = 261 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 27/40 (67%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDFD +R ++ RAH+A + M+ I +V Sbjct: 1 MLVDSHCHLDFPDFDGERDALVARAHEAGIGVMVTICTRV 40 >gi|254563517|ref|YP_003070612.1| metallo-dependent hydrolase, deoxyribonuclease, TatD family [Methylobacterium extorquens DM4] gi|254270795|emb|CAX26800.1| putative metallo-dependent hydrolase, putative deoxyribonuclease, TatD family [Methylobacterium extorquens DM4] Length = 265 Score = 45.4 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D VI RA QA V +++ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAQDIPGVIARAAQAGVTRLLTISTRVAK 42 >gi|218532445|ref|YP_002423261.1| hydrolase, TatD family [Methylobacterium chloromethanicum CM4] gi|218524748|gb|ACK85333.1| hydrolase, TatD family [Methylobacterium chloromethanicum CM4] Length = 265 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D VI RA QA V +++ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAQDIPGVIARAAQAGVTRLLTISTRVAK 42 >gi|170747933|ref|YP_001754193.1| TatD family hydrolase [Methylobacterium radiotolerans JCM 2831] gi|170654455|gb|ACB23510.1| hydrolase, TatD family [Methylobacterium radiotolerans JCM 2831] Length = 266 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI++HCH PDF D VI RA A V M+ IA +V + Sbjct: 1 MLIDSHCHLDFPDFSADLPGVIARARAAGVTGMLTIATRVAK 42 >gi|157787034|ref|NP_001099457.1| hypothetical protein LOC289378 [Rattus norvegicus] gi|149041032|gb|EDL94989.1| rCG20352 [Rattus norvegicus] Length = 271 Score = 44.7 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 26/36 (72%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSAPDFDSDLDDVLEKARKANVMALVAVA 40 >gi|221632751|ref|YP_002521973.1| TatD-related deoxyribonuclease [Thermomicrobium roseum DSM 5159] gi|221156726|gb|ACM05853.1| TatD-related deoxyribonuclease [Thermomicrobium roseum DSM 5159] Length = 259 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 21/42 (50%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 +L++THCH LPDFD DR VI RA A V + IA R Sbjct: 2 ILVDTHCHLDLPDFDNDRPLVIERARDAGVQGFVLIAFSPTR 43 >gi|163868325|ref|YP_001609534.1| putative deoxyribonuclease [Bartonella tribocorum CIP 105476] gi|161017981|emb|CAK01539.1| putative deoxyribonuclease [Bartonella tribocorum CIP 105476] Length = 257 Score = 44.3 bits (103), Expect = 0.005, Method: Composition-based stats. Identities = 21/40 (52%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF +D NVI RA A+V +MI I+ V Sbjct: 1 MLIDTHCHLDFEDFSQDLDNVIQRALDADVRRMITISTHV 40 >gi|27379626|ref|NP_771155.1| hypothetical protein bll4515 [Bradyrhizobium japonicum USDA 110] gi|27352778|dbj|BAC49780.1| bll4515 [Bradyrhizobium japonicum USDA 110] Length = 258 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF ED ++ RA A + +M+ I+ +V Sbjct: 1 MLVDSHCHLDFPDFAEDLDGIVSRARAAGIGRMVTISTRV 40 >gi|240141003|ref|YP_002965483.1| putative metallo-dependent hydrolase, putative deoxyribonuclease, TatD family [Methylobacterium extorquens AM1] gi|240010980|gb|ACS42206.1| putative metallo-dependent hydrolase, putative deoxyribonuclease, TatD family [Methylobacterium extorquens AM1] Length = 265 Score = 44.3 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D VI RA +A V +++ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAQDIPGVIARAAEAGVTRLLTISTRVAK 42 >gi|115524874|ref|YP_781785.1| TatD family hydrolase [Rhodopseudomonas palustris BisA53] gi|115518821|gb|ABJ06805.1| hydrolase, TatD family [Rhodopseudomonas palustris BisA53] Length = 262 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF ED ++ RA A V +M+ I+ +V Sbjct: 1 MLVDSHCHLDFPDFAEDLDGIVSRAGAAGVGRMVTISTRV 40 >gi|312115062|ref|YP_004012658.1| hydrolase, TatD family [Rhodomicrobium vannielii ATCC 17100] gi|311220191|gb|ADP71559.1| hydrolase, TatD family [Rhodomicrobium vannielii ATCC 17100] Length = 269 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 27/40 (67%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH P+F+ R +VI RA +A V M+ I+ ++ Sbjct: 1 MLVDSHCHLDFPEFEPQRDDVIARAREAGVGHMVTISTRI 40 >gi|319943689|ref|ZP_08017970.1| hydrogenase nickel insertion protein HypA [Lautropia mirabilis ATCC 51599] gi|319742922|gb|EFV95328.1| hydrogenase nickel insertion protein HypA [Lautropia mirabilis ATCC 51599] Length = 271 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 19/38 (50%), Positives = 25/38 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 MLI+THCH P+FDEDR VI A QA + ++ A+ Sbjct: 1 MLIDTHCHLDAPEFDEDRDAVIAAARQAGLGAIVVPAV 38 >gi|297568539|ref|YP_003689883.1| hydrolase, TatD family [Desulfurivibrio alkaliphilus AHT2] gi|296924454|gb|ADH85264.1| hydrolase, TatD family [Desulfurivibrio alkaliphilus AHT2] Length = 277 Score = 43.9 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 18/39 (46%), Positives = 25/39 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 LI+THCH PD+ D V+ RA QA V +MI++ I + Sbjct: 19 LIDTHCHLDFPDYQADLEQVVGRAAQAGVRQMISVGIDL 57 >gi|146340772|ref|YP_001205820.1| putative deoxyribonuclease (ycfH) [Bradyrhizobium sp. ORS278] gi|146193578|emb|CAL77595.1| Putative deoxyribonuclease (ycfH) [Bradyrhizobium sp. ORS278] Length = 263 Score = 43.9 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF ED ++ RA A V +++ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAEDLDGIVTRAAAAGVGRLVTISTRVRR 42 >gi|110633936|ref|YP_674144.1| TatD family hydrolase [Mesorhizobium sp. BNC1] gi|110284920|gb|ABG62979.1| hydrolase, TatD family [Chelativorans sp. BNC1] Length = 264 Score = 43.5 bits (101), Expect = 0.008, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF+ +R +I RA A V M+ I+ +V Sbjct: 1 MLVDSHCHLDFPDFEAERDQIIARAGDAGVGLMVTISTRV 40 >gi|92117537|ref|YP_577266.1| TatD-related deoxyribonuclease [Nitrobacter hamburgensis X14] gi|91800431|gb|ABE62806.1| TatD-related deoxyribonuclease [Nitrobacter hamburgensis X14] Length = 263 Score = 43.5 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF +D ++ RA A V +M+ I+ +V Sbjct: 1 MLVDSHCHLDFPDFADDLDGIVSRAEAAGVSRMVTISTRV 40 >gi|260426719|ref|ZP_05780698.1| hydrolase, TatD family [Citreicella sp. SE45] gi|260421211|gb|EEX14462.1| hydrolase, TatD family [Citreicella sp. SE45] Length = 268 Score = 43.5 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 26/39 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDFDE+R +VI RA A V +M+ I ++ Sbjct: 6 ITDSHCHLDFPDFDEERADVISRAVAAGVHRMVTICTRL 44 >gi|182678509|ref|YP_001832655.1| TatD family hydrolase [Beijerinckia indica subsp. indica ATCC 9039] gi|182634392|gb|ACB95166.1| hydrolase, TatD family [Beijerinckia indica subsp. indica ATCC 9039] Length = 271 Score = 43.5 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF +R ++ RA A + +MI I+ ++ R Sbjct: 1 MLIDTHCHLDFPDFAAERDEIVGRARAAGLGRMITISTRIDR 42 >gi|154253554|ref|YP_001414378.1| TatD family hydrolase [Parvibaculum lavamentivorans DS-1] gi|154157504|gb|ABS64721.1| hydrolase, TatD family [Parvibaculum lavamentivorans DS-1] Length = 268 Score = 43.5 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +LI++HCH PDF + V+ RAH+A V M+ I+ KV Sbjct: 5 VLIDSHCHLDFPDFGAEVEEVVARAHEAGVGLMVTISTKV 44 >gi|299133887|ref|ZP_07027081.1| hydrolase, TatD family [Afipia sp. 1NLS2] gi|298591723|gb|EFI51924.1| hydrolase, TatD family [Afipia sp. 1NLS2] Length = 264 Score = 43.5 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D ++ RA A V ++I I+ +V R Sbjct: 1 MLVDSHCHLDFPDFADDLDGIVARAEAAGVGRIITISTRVRR 42 >gi|209964482|ref|YP_002297397.1| hydrolase, TatD family [Rhodospirillum centenum SW] gi|209957948|gb|ACI98584.1| hydrolase, TatD family [Rhodospirillum centenum SW] Length = 264 Score = 43.1 bits (100), Expect = 0.011, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF E+R V+ RA +A V M+ I R Sbjct: 1 MLVDSHCHLDFPDFQEERDQVVQRAREAGVGLMLTICTHASR 42 >gi|188583888|ref|YP_001927333.1| hydrolase, TatD family [Methylobacterium populi BJ001] gi|179347386|gb|ACB82798.1| hydrolase, TatD family [Methylobacterium populi BJ001] Length = 265 Score = 43.1 bits (100), Expect = 0.011, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D VI RA A V +++ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAQDIPGVIARARDAGVTRLLTISTRVAK 42 >gi|122692429|ref|NP_001073789.1| putative deoxyribonuclease TATDN3 [Bos taurus] gi|166227802|sp|A1A4M4|TATD3_BOVIN RecName: Full=Putative deoxyribonuclease TATDN3 gi|119224018|gb|AAI26725.1| TatD DNase domain containing 3 [Bos taurus] gi|296478867|gb|DAA20982.1| putative deoxyribonuclease TATDN3 [Bos taurus] Length = 273 Score = 43.1 bits (100), Expect = 0.011, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ +A +ANV+ ++ +A Sbjct: 8 LVDCHCHLSAPDFDHDLDDVLKKAKEANVMALVVVA 43 >gi|86749799|ref|YP_486295.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris HaA2] gi|86572827|gb|ABD07384.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris HaA2] Length = 265 Score = 43.1 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D ++ RA + V +M+ I+ +V R Sbjct: 3 MLVDSHCHLDFPDFADDLAGIVARAEASGVGRMVTISTRVKR 44 >gi|254500560|ref|ZP_05112711.1| hydrolase, TatD family [Labrenzia alexandrii DFL-11] gi|222436631|gb|EEE43310.1| hydrolase, TatD family [Labrenzia alexandrii DFL-11] Length = 270 Score = 43.1 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 25/40 (62%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M++++HCH PDFD +R +I RA +A V M+ I V Sbjct: 1 MIVDSHCHLDFPDFDGERDELIARAKEAGVELMVTICTHV 40 >gi|91977189|ref|YP_569848.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris BisB5] gi|91683645|gb|ABE39947.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris BisB5] Length = 263 Score = 43.1 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI++HCH PDF +D ++ RA + V +M+ I+ +V R Sbjct: 1 MLIDSHCHLDFPDFADDLDGIVARAAASGVGRMVTISTRVRR 42 >gi|49475613|ref|YP_033654.1| hypothetical protein BH08490 [Bartonella henselae str. Houston-1] gi|49238420|emb|CAF27647.1| hypothetical protein BH08490 [Bartonella henselae str. Houston-1] Length = 257 Score = 43.1 bits (100), Expect = 0.013, Method: Compositional matrix adjust. Identities = 21/40 (52%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF +D +VI RA ANV +MI I+ V Sbjct: 1 MLIDTHCHLDFEDFSQDLDDVIQRALDANVKRMITISTHV 40 >gi|163853583|ref|YP_001641626.1| TatD family hydrolase [Methylobacterium extorquens PA1] gi|163665188|gb|ABY32555.1| hydrolase, TatD family [Methylobacterium extorquens PA1] Length = 265 Score = 42.7 bits (99), Expect = 0.014, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D VI RA A V +++ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAQDIPGVIARAADAGVTRLLTISTRVAK 42 >gi|240850630|ref|YP_002972030.1| hydrolase, TatD family [Bartonella grahamii as4aup] gi|240267753|gb|ACS51341.1| hydrolase, TatD family [Bartonella grahamii as4aup] Length = 257 Score = 42.7 bits (99), Expect = 0.015, Method: Compositional matrix adjust. Identities = 21/40 (52%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF +D NVI RA A+V +MI I+ V Sbjct: 1 MLIDTHCHLDFEDFSQDLDNVIQRALDADVKRMITISTHV 40 >gi|149708616|ref|XP_001488838.1| PREDICTED: similar to TatD DNase domain containing 3 [Equus caballus] Length = 273 Score = 42.7 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ +A +ANV+ ++ +A Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKKANVMALVVVA 43 >gi|84499969|ref|ZP_00998235.1| hydrolase, TatD family protein [Oceanicola batsensis HTCC2597] gi|84391903|gb|EAQ04171.1| hydrolase, TatD family protein [Oceanicola batsensis HTCC2597] Length = 271 Score = 42.7 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 26/39 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDFD++R VI RA +A V +M+ I K+ Sbjct: 8 ITDSHCHLDFPDFDDERDAVIARAIEAGVGRMVTICTKL 46 >gi|149201818|ref|ZP_01878792.1| hydrolase, TatD family protein [Roseovarius sp. TM1035] gi|149144866|gb|EDM32895.1| hydrolase, TatD family protein [Roseovarius sp. TM1035] Length = 263 Score = 42.4 bits (98), Expect = 0.019, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDFDE+R VI RA A V +M+ I ++ Sbjct: 7 ITDSHCHLDFPDFDEERDQVISRAVAAGVHRMVTICTRL 45 >gi|118589862|ref|ZP_01547266.1| hypothetical protein SIAM614_14395 [Stappia aggregata IAM 12614] gi|118437359|gb|EAV43996.1| hypothetical protein SIAM614_14395 [Stappia aggregata IAM 12614] Length = 268 Score = 42.4 bits (98), Expect = 0.019, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 25/40 (62%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDFD +R ++I RA A V M+ I + Sbjct: 1 MLVDSHCHLDFPDFDGERADLIARAKAAGVELMVTICTHI 40 >gi|268317732|ref|YP_003291451.1| hydrolase, TatD family [Rhodothermus marinus DSM 4252] gi|262335266|gb|ACY49063.1| hydrolase, TatD family [Rhodothermus marinus DSM 4252] Length = 263 Score = 42.4 bits (98), Expect = 0.020, Method: Composition-based stats. Identities = 20/39 (51%), Positives = 25/39 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 LI+TH H L FDEDR V+ RA +A V+ M+ AI V Sbjct: 4 LIDTHVHLYLEAFDEDRDEVVARAREAGVVAMVLPAIDV 42 >gi|288958660|ref|YP_003449001.1| Mg-dependent DNase [Azospirillum sp. B510] gi|288910968|dbj|BAI72457.1| Mg-dependent DNase [Azospirillum sp. B510] Length = 264 Score = 42.4 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF E+ V+ RA QA + +M+ I + R Sbjct: 1 MLVDSHCHLDFPDFTEELDAVVDRARQAGIGRMVTICTYISR 42 >gi|316934060|ref|YP_004109042.1| hydrolase [Rhodopseudomonas palustris DX-1] gi|315601774|gb|ADU44309.1| hydrolase, TatD family [Rhodopseudomonas palustris DX-1] Length = 264 Score = 42.4 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF +D ++ RA + V +M+ I+ +V Sbjct: 3 MLVDSHCHLDFPDFADDLAGIVARAEASGVGRMVTISTRV 42 >gi|192291493|ref|YP_001992098.1| hydrolase, TatD family [Rhodopseudomonas palustris TIE-1] gi|192285242|gb|ACF01623.1| hydrolase, TatD family [Rhodopseudomonas palustris TIE-1] Length = 262 Score = 42.4 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF +D ++ RA + V +M+ I+ +V Sbjct: 1 MLVDSHCHLDFPDFADDLAGIVARAEASGVGRMVTISTRV 40 >gi|39935845|ref|NP_948121.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris CGA009] gi|39649699|emb|CAE28220.1| possible deoxyribonuclease [Rhodopseudomonas palustris CGA009] Length = 262 Score = 42.4 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF +D ++ RA + V +M+ I+ +V Sbjct: 1 MLVDSHCHLDFPDFADDLAGIVARAEASGVGRMVTISTRV 40 >gi|12837586|dbj|BAB23875.1| unnamed protein product [Mus musculus] Length = 189 Score = 42.0 bits (97), Expect = 0.028, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ RA +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLERARKANVMALVAVA 40 >gi|85715530|ref|ZP_01046511.1| TatD-related deoxyribonuclease [Nitrobacter sp. Nb-311A] gi|85697725|gb|EAQ35601.1| TatD-related deoxyribonuclease [Nitrobacter sp. Nb-311A] Length = 263 Score = 42.0 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF ++ V+ RA A V +M+ I+ +V Sbjct: 1 MLVDSHCHLDYPDFSDELDAVVARAEAAGVGRMVTISTRV 40 >gi|319407221|emb|CBI80860.1| putative deoxyribonuclease [Bartonella sp. 1-1C] Length = 257 Score = 42.0 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 20/40 (50%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF +D + +I RA ANV +MI I+ V Sbjct: 1 MLIDTHCHLDFEDFSQDLNGIIQRALAANVGRMITISTHV 40 >gi|253998547|ref|YP_003050610.1| TatD-like deoxyribonuclease [Methylovorus sp. SIP3-4] gi|253985226|gb|ACT50083.1| TatD-related deoxyribonuclease [Methylovorus sp. SIP3-4] Length = 255 Score = 42.0 bits (97), Expect = 0.030, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 27/40 (67%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML++THCH +FD+DR ++ +RA A V +++ A++ Sbjct: 1 MLVDTHCHLDASEFDDDRADIALRAQDAGVARIVVPAVEA 40 >gi|85859109|ref|YP_461311.1| sec-independent protein translocase protein [Syntrophus aciditrophicus SB] gi|85722200|gb|ABC77143.1| sec-independent protein translocase protein [Syntrophus aciditrophicus SB] Length = 255 Score = 42.0 bits (97), Expect = 0.030, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M+I++H H LP+FD DR VI RA +A V ++ I I + Sbjct: 1 MMIDSHAHLELPEFDSDRDEVIARAKEAGVDAIVTIGIDL 40 >gi|319405651|emb|CBI79274.1| putative deoxyribonuclease [Bartonella sp. AR 15-3] Length = 258 Score = 42.0 bits (97), Expect = 0.031, Method: Compositional matrix adjust. Identities = 19/37 (51%), Positives = 25/37 (67%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+THCH DF +D + +I RA ANV +MI I+ Sbjct: 2 MLIDTHCHLDFEDFSQDLNGIIQRALTANVGRMITIS 38 >gi|238927711|ref|ZP_04659471.1| TatD deoxyribonuclease [Selenomonas flueggei ATCC 43531] gi|238884427|gb|EEQ48065.1| TatD deoxyribonuclease [Selenomonas flueggei ATCC 43531] Length = 257 Score = 41.6 bits (96), Expect = 0.033, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI+TH H FD+DR +VI RAH+A V K+I++ Sbjct: 3 LIDTHAHLCDEKFDDDRIDVIARAHEAGVTKIISMG 38 >gi|49474217|ref|YP_032259.1| hypothetical protein BQ06080 [Bartonella quintana str. Toulouse] gi|49239721|emb|CAF26100.1| hypothetical protein BQ06080 [Bartonella quintana str. Toulouse] Length = 257 Score = 41.6 bits (96), Expect = 0.033, Method: Compositional matrix adjust. Identities = 19/40 (47%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M I+THCH DF +D +VI RA ANV +MI I+ ++ Sbjct: 1 MFIDTHCHLDFEDFSQDLDDVIQRALDANVRRMITISTQL 40 >gi|253576894|ref|ZP_04854219.1| hydrolase [Paenibacillus sp. oral taxon 786 str. D14] gi|251843761|gb|EES71784.1| hydrolase [Paenibacillus sp. oral taxon 786 str. D14] Length = 257 Score = 41.6 bits (96), Expect = 0.037, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ML +TH H P FDEDR VI RA + V +MI I Sbjct: 1 MLFDTHTHLDAPQFDEDREEVIARAVEQGVTRMINIG 37 >gi|126736699|ref|ZP_01752438.1| TatD-related deoxyribonuclease [Roseobacter sp. CCS2] gi|126713814|gb|EBA10686.1| TatD-related deoxyribonuclease [Roseobacter sp. CCS2] Length = 262 Score = 41.6 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 25/39 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++++HCH PDFD +R +I RA A V +M+ I K+ Sbjct: 6 IVDSHCHLDFPDFDGERDALIARAIDAGVTRMVTICTKL 44 >gi|114763015|ref|ZP_01442445.1| hydrolase, TatD family protein [Pelagibaca bermudensis HTCC2601] gi|114544339|gb|EAU47347.1| hydrolase, TatD family protein [Roseovarius sp. HTCC2601] Length = 268 Score = 41.6 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 24/36 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ++ ++HCH PDFD +R +VI RA A V +M+ I Sbjct: 5 LITDSHCHLDFPDFDAERPDVIARAVDAGVHRMVTI 40 >gi|291402417|ref|XP_002717566.1| PREDICTED: putative deoxyribonuclease TATDN3-like isoform 2 [Oryctolagus cuniculus] Length = 253 Score = 41.6 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 24/36 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ A + NV+ ++A+A Sbjct: 8 LVDCHCHLSAPDFDHDLDDVLEEAKKVNVMALVAVA 43 >gi|254714083|ref|ZP_05175894.1| SEC-independent protein TATD [Brucella ceti M644/93/1] gi|254716861|ref|ZP_05178672.1| SEC-independent protein TATD [Brucella ceti M13/05/1] Length = 263 Score = 41.6 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 49 >gi|75675653|ref|YP_318074.1| TatD-related deoxyribonuclease [Nitrobacter winogradskyi Nb-255] gi|74420523|gb|ABA04722.1| TatD-related deoxyribonuclease [Nitrobacter winogradskyi Nb-255] Length = 263 Score = 41.6 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF ++ V+ RA A V +M+ I+ +V Sbjct: 1 MLVDSHCHLDFPDFADELDAVVARAEAAGVGRMVTISTRV 40 >gi|310765167|gb|ADP10117.1| Mg-dependent DNase [Erwinia sp. Ejp617] Length = 258 Score = 41.2 bits (95), Expect = 0.041, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 24/41 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++THCHF P F D + RA QA V KMIA+++ R Sbjct: 5 FVDTHCHFDFPPFVGDEEASLQRAAQAGVEKMIAVSVSATR 45 >gi|306843871|ref|ZP_07476466.1| hydrolase, TatD family [Brucella sp. BO1] gi|306275626|gb|EFM57350.1| hydrolase, TatD family [Brucella sp. BO1] Length = 263 Score = 41.2 bits (95), Expect = 0.041, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 49 >gi|259907336|ref|YP_002647692.1| Mg-dependent DNase [Erwinia pyrifoliae Ep1/96] gi|224962958|emb|CAX54439.1| Mg-dependent DNase [Erwinia pyrifoliae Ep1/96] gi|283477158|emb|CAY73065.1| yjjV [Erwinia pyrifoliae DSM 12163] Length = 258 Score = 41.2 bits (95), Expect = 0.041, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 24/41 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++THCHF P F D + RA QA V KMIA+++ R Sbjct: 5 FVDTHCHFDFPPFVGDEEASLQRAAQAGVEKMIAVSVSATR 45 >gi|209885247|ref|YP_002289104.1| putative deoxyribonuclease [Oligotropha carboxidovorans OM5] gi|209873443|gb|ACI93239.1| putative deoxyribonuclease [Oligotropha carboxidovorans OM5] Length = 264 Score = 41.2 bits (95), Expect = 0.041, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PD+ ++ V+ RA A+V +++ I+ +V R Sbjct: 1 MLVDSHCHLDFPDYGDELDAVVARAEAADVKRIVTISTRVKR 42 >gi|315644355|ref|ZP_07897495.1| hydrolase, TatD family protein [Paenibacillus vortex V453] gi|315280232|gb|EFU43524.1| hydrolase, TatD family protein [Paenibacillus vortex V453] Length = 254 Score = 41.2 bits (95), Expect = 0.043, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ML +TH H P FDEDR I RA +A V +MI I Sbjct: 1 MLFDTHTHLDAPQFDEDREETIARALEAGVSRMINIG 37 >gi|313200622|ref|YP_004039280.1| tatd-like deoxyribonuclease [Methylovorus sp. MP688] gi|312439938|gb|ADQ84044.1| TatD-related deoxyribonuclease [Methylovorus sp. MP688] Length = 255 Score = 41.2 bits (95), Expect = 0.043, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 27/40 (67%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML++THCH +FD+DR ++ +RA A V +++ A++ Sbjct: 1 MLVDTHCHLDASEFDDDRADIAVRAQDAGVARIVVPAVEA 40 >gi|261218662|ref|ZP_05932943.1| hydrolase [Brucella ceti M13/05/1] gi|261321840|ref|ZP_05961037.1| hydrolase [Brucella ceti M644/93/1] gi|260923751|gb|EEX90319.1| hydrolase [Brucella ceti M13/05/1] gi|261294530|gb|EEX98026.1| hydrolase [Brucella ceti M644/93/1] Length = 264 Score = 41.2 bits (95), Expect = 0.043, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 50 >gi|254719074|ref|ZP_05180885.1| Sec-independent protein TATD [Brucella sp. 83/13] gi|306838356|ref|ZP_07471201.1| hydrolase, TatD family [Brucella sp. NF 2653] gi|306406496|gb|EFM62730.1| hydrolase, TatD family [Brucella sp. NF 2653] Length = 263 Score = 41.2 bits (95), Expect = 0.043, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 49 >gi|198283234|ref|YP_002219555.1| TatD family hydrolase [Acidithiobacillus ferrooxidans ATCC 53993] gi|218666863|ref|YP_002425466.1| hydrolase, TatD family [Acidithiobacillus ferrooxidans ATCC 23270] gi|198247755|gb|ACH83348.1| hydrolase, TatD family [Acidithiobacillus ferrooxidans ATCC 53993] gi|218519076|gb|ACK79662.1| hydrolase, TatD family [Acidithiobacillus ferrooxidans ATCC 23270] Length = 257 Score = 41.2 bits (95), Expect = 0.043, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 24/38 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ML+++HCH DFD DR ++ RA A V +M+ A+ Sbjct: 1 MLVDSHCHLDFEDFDADRSEILARARAAGVGEMLIAAV 38 >gi|23501877|ref|NP_698004.1| TatD family hydrolase [Brucella suis 1330] gi|161618950|ref|YP_001592837.1| TatD family hydrolase [Brucella canis ATCC 23365] gi|254704290|ref|ZP_05166118.1| TatD family hydrolase [Brucella suis bv. 3 str. 686] gi|23347816|gb|AAN29919.1| hydrolase, TatD family [Brucella suis 1330] gi|161335761|gb|ABX62066.1| hydrolase, TatD family [Brucella canis ATCC 23365] Length = 263 Score = 41.2 bits (95), Expect = 0.043, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 49 >gi|326804010|ref|YP_004321828.1| hydrolase, TatD family [Aerococcus urinae ACS-120-V-Col10a] gi|326650483|gb|AEA00666.1| hydrolase, TatD family [Aerococcus urinae ACS-120-V-Col10a] Length = 265 Score = 41.2 bits (95), Expect = 0.044, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 20/33 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 ML +TH HF DFDEDR I RA QA V M Sbjct: 1 MLFDTHTHFNTADFDEDRDQAIERARQAGVSGM 33 >gi|291402415|ref|XP_002717565.1| PREDICTED: putative deoxyribonuclease TATDN3-like isoform 1 [Oryctolagus cuniculus] Length = 273 Score = 41.2 bits (95), Expect = 0.044, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 24/36 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ A + NV+ ++A+A Sbjct: 8 LVDCHCHLSAPDFDHDLDDVLEEAKKVNVMALVAVA 43 >gi|306840484|ref|ZP_07473243.1| hydrolase, TatD family [Brucella sp. BO2] gi|306289499|gb|EFM60717.1| hydrolase, TatD family [Brucella sp. BO2] Length = 264 Score = 41.2 bits (95), Expect = 0.045, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALNAGIKRMVTISTRVRKFDAIRTL 50 >gi|62289920|ref|YP_221713.1| TatD family hydrolase [Brucella abortus bv. 1 str. 9-941] gi|82699847|ref|YP_414421.1| TatD-related deoxyribonuclease [Brucella melitensis biovar Abortus 2308] gi|163843265|ref|YP_001627669.1| TatD family hydrolase [Brucella suis ATCC 23445] gi|225852501|ref|YP_002732734.1| TatD family hydrolase [Brucella melitensis ATCC 23457] gi|254689227|ref|ZP_05152481.1| SEC-independent protein TATD [Brucella abortus bv. 6 str. 870] gi|254697362|ref|ZP_05159190.1| SEC-independent protein TATD [Brucella abortus bv. 2 str. 86/8/59] gi|254701748|ref|ZP_05163576.1| SEC-independent protein TATD [Brucella suis bv. 5 str. 513] gi|254710082|ref|ZP_05171893.1| SEC-independent protein TATD [Brucella pinnipedialis B2/94] gi|254730260|ref|ZP_05188838.1| SEC-independent protein TATD [Brucella abortus bv. 4 str. 292] gi|256031578|ref|ZP_05445192.1| SEC-independent protein TATD [Brucella pinnipedialis M292/94/1] gi|256044656|ref|ZP_05447560.1| SEC-independent protein TATD [Brucella melitensis bv. 1 str. Rev.1] gi|256061088|ref|ZP_05451243.1| SEC-independent protein TATD [Brucella neotomae 5K33] gi|256113543|ref|ZP_05454369.1| SEC-independent protein TATD [Brucella melitensis bv. 3 str. Ether] gi|256159716|ref|ZP_05457463.1| SEC-independent protein TATD [Brucella ceti M490/95/1] gi|256254978|ref|ZP_05460514.1| SEC-independent protein TATD [Brucella ceti B1/94] gi|256257477|ref|ZP_05463013.1| SEC-independent protein TATD [Brucella abortus bv. 9 str. C68] gi|62196052|gb|AAX74352.1| hydrolase, TatD family [Brucella abortus bv. 1 str. 9-941] gi|82615948|emb|CAJ10971.1| TatD-related deoxyribonuclease [Brucella melitensis biovar Abortus 2308] gi|163673988|gb|ABY38099.1| hydrolase, TatD family [Brucella suis ATCC 23445] gi|225640866|gb|ACO00780.1| hydrolase, TatD family protein [Brucella melitensis ATCC 23457] gi|326409017|gb|ADZ66082.1| Sec-independent protein TATD [Brucella melitensis M28] gi|326538727|gb|ADZ86942.1| hydrolase, TatD family protein [Brucella melitensis M5-90] Length = 263 Score = 41.2 bits (95), Expect = 0.045, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 49 >gi|254540124|ref|NP_001156893.1| putative deoxyribonuclease TATDN3 isoform 2 [Mus musculus] Length = 232 Score = 41.2 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 40 >gi|254540122|ref|NP_081171.1| putative deoxyribonuclease TATDN3 isoform 1 [Mus musculus] Length = 294 Score = 41.2 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 40 >gi|148681060|gb|EDL13007.1| mCG14106, isoform CRA_a [Mus musculus] Length = 293 Score = 41.2 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 40 >gi|148681062|gb|EDL13009.1| mCG14106, isoform CRA_c [Mus musculus] Length = 205 Score = 41.2 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 21 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 56 >gi|38174687|gb|AAH61248.1| Tatdn3 protein [Mus musculus] gi|148681061|gb|EDL13008.1| mCG14106, isoform CRA_b [Mus musculus] Length = 247 Score = 41.2 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 20 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 55 >gi|123790766|sp|Q3U1C6|TATD3_MOUSE RecName: Full=Putative deoxyribonuclease TATDN3 gi|74217670|dbj|BAE33572.1| unnamed protein product [Mus musculus] gi|148681063|gb|EDL13010.1| mCG14106, isoform CRA_d [Mus musculus] Length = 294 Score = 41.2 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 40 >gi|85706303|ref|ZP_01037397.1| hydrolase, TatD family protein [Roseovarius sp. 217] gi|85669076|gb|EAQ23943.1| hydrolase, TatD family protein [Roseovarius sp. 217] Length = 263 Score = 41.2 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 25/39 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDFD++R VI RA A V +M+ I ++ Sbjct: 7 ITDSHCHLDFPDFDDERDEVITRAVAAGVHRMVTICTRL 45 >gi|254693712|ref|ZP_05155540.1| SEC-independent protein TATD [Brucella abortus bv. 3 str. Tulya] gi|261213984|ref|ZP_05928265.1| hydrolase [Brucella abortus bv. 3 str. Tulya] gi|260915591|gb|EEX82452.1| hydrolase [Brucella abortus bv. 3 str. Tulya] Length = 263 Score = 41.2 bits (95), Expect = 0.047, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 49 >gi|148559388|ref|YP_001258937.1| TatD family hydrolase [Brucella ovis ATCC 25840] gi|294852412|ref|ZP_06793085.1| Mg-dependent DNase [Brucella sp. NVSL 07-0026] gi|148370645|gb|ABQ60624.1| hydrolase, TatD family [Brucella ovis ATCC 25840] gi|294821001|gb|EFG38000.1| Mg-dependent DNase [Brucella sp. NVSL 07-0026] Length = 263 Score = 41.2 bits (95), Expect = 0.047, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 49 >gi|301763633|ref|XP_002917240.1| PREDICTED: putative deoxyribonuclease TATDN3-like, partial [Ailuropoda melanoleuca] Length = 283 Score = 41.2 bits (95), Expect = 0.048, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 24/35 (68%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ++ HCH PDFD D +V+ +A +ANV+ ++ +A Sbjct: 11 VDCHCHLSAPDFDSDLDDVLEKAKKANVMALVVVA 45 >gi|265984064|ref|ZP_06096799.1| hydrolase [Brucella sp. 83/13] gi|264662656|gb|EEZ32917.1| hydrolase [Brucella sp. 83/13] Length = 264 Score = 41.2 bits (95), Expect = 0.048, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 50 >gi|260566463|ref|ZP_05836933.1| sec-independent protein TATD [Brucella suis bv. 4 str. 40] gi|261754958|ref|ZP_05998667.1| hydrolase [Brucella suis bv. 3 str. 686] gi|260155981|gb|EEW91061.1| sec-independent protein TATD [Brucella suis bv. 4 str. 40] gi|261744711|gb|EEY32637.1| hydrolase [Brucella suis bv. 3 str. 686] Length = 264 Score = 41.2 bits (95), Expect = 0.048, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 50 >gi|189024162|ref|YP_001934930.1| Sec-independent protein TATD [Brucella abortus S19] gi|260545331|ref|ZP_05821072.1| sec-independent protein TATD [Brucella abortus NCTC 8038] gi|260564002|ref|ZP_05834488.1| sec-independent protein TATD [Brucella melitensis bv. 1 str. 16M] gi|260754732|ref|ZP_05867080.1| hydrolase [Brucella abortus bv. 6 str. 870] gi|260757955|ref|ZP_05870303.1| hydrolase [Brucella abortus bv. 4 str. 292] gi|260761778|ref|ZP_05874121.1| hydrolase [Brucella abortus bv. 2 str. 86/8/59] gi|260883753|ref|ZP_05895367.1| hydrolase [Brucella abortus bv. 9 str. C68] gi|261222164|ref|ZP_05936445.1| hydrolase [Brucella ceti B1/94] gi|261317631|ref|ZP_05956828.1| hydrolase [Brucella pinnipedialis B2/94] gi|261325090|ref|ZP_05964287.1| hydrolase [Brucella neotomae 5K33] gi|261752301|ref|ZP_05996010.1| hydrolase [Brucella suis bv. 5 str. 513] gi|265988666|ref|ZP_06101223.1| hydrolase [Brucella pinnipedialis M292/94/1] gi|265991080|ref|ZP_06103637.1| hydrolase [Brucella melitensis bv. 1 str. Rev.1] gi|265994916|ref|ZP_06107473.1| hydrolase [Brucella melitensis bv. 3 str. Ether] gi|265998129|ref|ZP_06110686.1| hydrolase [Brucella ceti M490/95/1] gi|265999471|ref|ZP_05466540.2| sec-independent protein TATD [Brucella melitensis bv. 2 str. 63/9] gi|297248321|ref|ZP_06932039.1| deoxyribonuclease YcfH [Brucella abortus bv. 5 str. B3196] gi|189019734|gb|ACD72456.1| Sec-independent protein TATD [Brucella abortus S19] gi|260096738|gb|EEW80613.1| sec-independent protein TATD [Brucella abortus NCTC 8038] gi|260154018|gb|EEW89110.1| sec-independent protein TATD [Brucella melitensis bv. 1 str. 16M] gi|260668273|gb|EEX55213.1| hydrolase [Brucella abortus bv. 4 str. 292] gi|260672210|gb|EEX59031.1| hydrolase [Brucella abortus bv. 2 str. 86/8/59] gi|260674840|gb|EEX61661.1| hydrolase [Brucella abortus bv. 6 str. 870] gi|260873281|gb|EEX80350.1| hydrolase [Brucella abortus bv. 9 str. C68] gi|260920748|gb|EEX87401.1| hydrolase [Brucella ceti B1/94] gi|261296854|gb|EEY00351.1| hydrolase [Brucella pinnipedialis B2/94] gi|261301070|gb|EEY04567.1| hydrolase [Brucella neotomae 5K33] gi|261742054|gb|EEY29980.1| hydrolase [Brucella suis bv. 5 str. 513] gi|262552597|gb|EEZ08587.1| hydrolase [Brucella ceti M490/95/1] gi|262766029|gb|EEZ11818.1| hydrolase [Brucella melitensis bv. 3 str. Ether] gi|263001864|gb|EEZ14439.1| hydrolase [Brucella melitensis bv. 1 str. Rev.1] gi|263094152|gb|EEZ18074.1| sec-independent protein TATD [Brucella melitensis bv. 2 str. 63/9] gi|264660863|gb|EEZ31124.1| hydrolase [Brucella pinnipedialis M292/94/1] gi|297175490|gb|EFH34837.1| deoxyribonuclease YcfH [Brucella abortus bv. 5 str. B3196] Length = 264 Score = 41.2 bits (95), Expect = 0.050, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 50 >gi|307942272|ref|ZP_07657623.1| TatD family hydrolase [Roseibium sp. TrichSKD4] gi|307774558|gb|EFO33768.1| TatD family hydrolase [Roseibium sp. TrichSKD4] Length = 265 Score = 41.2 bits (95), Expect = 0.051, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 25/40 (62%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF+ + ++I RAH A V M+ I + Sbjct: 1 MLVDSHCHLDFPDFEGEHEDLIARAHGAGVGLMVTICTHI 40 >gi|319779406|ref|YP_004130319.1| Putative deoxyribonuclease YjjV [Taylorella equigenitalis MCE9] gi|317109430|gb|ADU92176.1| Putative deoxyribonuclease YjjV [Taylorella equigenitalis MCE9] Length = 267 Score = 41.2 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 20/38 (52%), Positives = 23/38 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH DF +D NVI RA VLK+I AI Sbjct: 1 MFIDTHCHLDALDFKQDLQNVISRAQDNGVLKIIIPAI 38 >gi|17987269|ref|NP_539903.1| SEC-independent protein TATD [Brucella melitensis bv. 1 str. 16M] gi|237815421|ref|ZP_04594419.1| hydrolase, TatD family [Brucella abortus str. 2308 A] gi|17982946|gb|AAL52167.1| sec-independent protein tatd [Brucella melitensis bv. 1 str. 16M] gi|237790258|gb|EEP64468.1| hydrolase, TatD family [Brucella abortus str. 2308 A] Length = 265 Score = 41.2 bits (95), Expect = 0.053, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 3 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 51 >gi|329925486|ref|ZP_08280360.1| hydrolase, TatD family [Paenibacillus sp. HGF5] gi|328939769|gb|EGG36109.1| hydrolase, TatD family [Paenibacillus sp. HGF5] Length = 254 Score = 40.8 bits (94), Expect = 0.054, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ML +TH H P FDEDR I RA +A V +MI I Sbjct: 1 MLFDTHTHMDAPQFDEDREAAIQRALEAGVTRMINIG 37 >gi|163795497|ref|ZP_02189463.1| hydrolase, TatD family protein [alpha proteobacterium BAL199] gi|159179096|gb|EDP63629.1| hydrolase, TatD family protein [alpha proteobacterium BAL199] Length = 268 Score = 40.8 bits (94), Expect = 0.056, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF + V+ RA +A V++M+ I +V R Sbjct: 1 MLVDSHCHLDFEDFASELDEVVARARRAGVVRMVTIGTRVRR 42 >gi|91773725|ref|YP_566417.1| TatD-related deoxyribonuclease [Methanococcoides burtonii DSM 6242] gi|91712740|gb|ABE52667.1| TatD-related deoxyribonuclease [Methanococcoides burtonii DSM 6242] Length = 281 Score = 40.8 bits (94), Expect = 0.056, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I++HCH P F+ DR I RAH A V+KM+ I + Sbjct: 34 VIDSHCHLDFPKFNRDRDKTIERAHNAGVVKMVNSGIDL 72 >gi|73960880|ref|XP_547404.2| PREDICTED: similar to B0432.8 [Canis familiaris] Length = 339 Score = 40.8 bits (94), Expect = 0.059, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 24/35 (68%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ++ HCH PDFD D +V+ +A +ANV+ ++ +A Sbjct: 9 VDCHCHLSAPDFDSDLDDVLEKAKKANVMALVMVA 43 >gi|261758185|ref|ZP_06001894.1| TatD family hydrolase [Brucella sp. F5/99] gi|261738169|gb|EEY26165.1| TatD family hydrolase [Brucella sp. F5/99] Length = 185 Score = 40.8 bits (94), Expect = 0.060, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 49 >gi|73668480|ref|YP_304495.1| sec-independent transport protein TatD [Methanosarcina barkeri str. Fusaro] gi|72395642|gb|AAZ69915.1| sec-independent transport protein TatD [Methanosarcina barkeri str. Fusaro] Length = 257 Score = 40.8 bits (94), Expect = 0.063, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I++HCH P F+ DR I+RA +A V+ M+ I + Sbjct: 10 IIDSHCHLDFPKFNRDREETILRAREAGVVGMVNSGISL 48 >gi|153009410|ref|YP_001370625.1| TatD family hydrolase [Ochrobactrum anthropi ATCC 49188] gi|151561298|gb|ABS14796.1| hydrolase, TatD family [Ochrobactrum anthropi ATCC 49188] Length = 264 Score = 40.8 bits (94), Expect = 0.064, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 27/40 (67%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH DF+ +R +++ RA A V +M+ I+ +V Sbjct: 2 MLVDSHCHLDFADFEPERDDIVQRALDARVRRMVTISTRV 41 >gi|82617403|emb|CAI64314.1| putative DNase [uncultured archaeon] Length = 268 Score = 40.8 bits (94), Expect = 0.064, Method: Composition-based stats. Identities = 17/30 (56%), Positives = 20/30 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANV 30 M+I++HCH P FD DRH VI RA A V Sbjct: 20 MMIDSHCHLDFPRFDSDRHEVIERARIAGV 49 >gi|261403900|ref|YP_003240141.1| TatD family hydrolase [Paenibacillus sp. Y412MC10] gi|261280363|gb|ACX62334.1| hydrolase, TatD family [Paenibacillus sp. Y412MC10] Length = 254 Score = 40.8 bits (94), Expect = 0.066, Method: Compositional matrix adjust. Identities = 19/37 (51%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ML +TH H P FDEDR I RA +A V +MI I Sbjct: 1 MLFDTHTHMDAPQFDEDREAAIHRALEAGVTRMINIG 37 >gi|254540126|ref|NP_001156894.1| putative deoxyribonuclease TATDN3 isoform 3 [Mus musculus] Length = 189 Score = 40.4 bits (93), Expect = 0.072, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 40 >gi|294676798|ref|YP_003577413.1| TatD-related deoxyribonuclease family protein [Rhodobacter capsulatus SB 1003] gi|294475618|gb|ADE85006.1| TatD-related deoxyribonuclease family protein [Rhodobacter capsulatus SB 1003] Length = 265 Score = 40.4 bits (93), Expect = 0.073, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 25/40 (62%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +L+++HCH PDF E+ V+ RA A V +M+ I ++ Sbjct: 7 LLVDSHCHLDFPDFAEELPEVVARARAAGVSRMVTICTRL 46 >gi|78189312|ref|YP_379650.1| TatD-related deoxyribonuclease [Chlorobium chlorochromatii CaD3] gi|78171511|gb|ABB28607.1| TatD-related deoxyribonuclease [Chlorobium chlorochromatii CaD3] Length = 268 Score = 40.4 bits (93), Expect = 0.077, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I++HCH PDFD DR++V+ R A V +I Sbjct: 1 MFIDSHCHLSFPDFDADRNDVLQRLQAAKVSLLI 34 >gi|307545133|ref|YP_003897612.1| hypothetical protein HELO_2543 [Halomonas elongata DSM 2581] gi|307217157|emb|CBV42427.1| hypothetical protein HELO_2543 [Halomonas elongata DSM 2581] Length = 253 Score = 40.4 bits (93), Expect = 0.077, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 21/37 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ML++ HCH PDF DR V+ RA A V + + A Sbjct: 1 MLVDAHCHLDFPDFSADRERVLARARAAGVERFVVPA 37 >gi|114704622|ref|ZP_01437530.1| hypothetical protein FP2506_06796 [Fulvimarina pelagi HTCC2506] gi|114539407|gb|EAU42527.1| hypothetical protein FP2506_06796 [Fulvimarina pelagi HTCC2506] Length = 265 Score = 40.4 bits (93), Expect = 0.078, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 26/41 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++++HCH PDF+EDR +I RA +V + I+ KV + Sbjct: 3 IVDSHCHLDFPDFEEDRDALIERASTNDVRLFVTISTKVAK 43 >gi|319404211|emb|CBI77804.1| putative deoxyribonuclease [Bartonella rochalimae ATCC BAA-1498] Length = 257 Score = 40.4 bits (93), Expect = 0.081, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 24/37 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+THCH DF +D +I RA ANV +MI I+ Sbjct: 1 MLIDTHCHLDFEDFSQDLSGIIQRALAANVGRMITIS 37 >gi|323136440|ref|ZP_08071522.1| hydrolase, TatD family [Methylocystis sp. ATCC 49242] gi|322398514|gb|EFY01034.1| hydrolase, TatD family [Methylocystis sp. ATCC 49242] Length = 297 Score = 40.4 bits (93), Expect = 0.090, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF ++ +I RA V +MI I+ + R Sbjct: 35 MLIDTHCHLDFPDFAPEQAEIIARAKARGVGRMITISTHLSR 76 >gi|329889612|ref|ZP_08267955.1| hydrolase, TatD family protein [Brevundimonas diminuta ATCC 11568] gi|328844913|gb|EGF94477.1| hydrolase, TatD family protein [Brevundimonas diminuta ATCC 11568] Length = 261 Score = 40.0 bits (92), Expect = 0.091, Method: Composition-based stats. Identities = 20/40 (50%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P FDEDR VI RA QA V M+ I+ K+ Sbjct: 1 MLIDSHVNLHAPQFDEDREAVIDRARQAGVRLMVEISDKL 40 >gi|311265029|ref|XP_003130453.1| PREDICTED: putative deoxyribonuclease TATDN3-like [Sus scrofa] Length = 253 Score = 40.0 bits (92), Expect = 0.092, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ +A +A+V+ ++ +A Sbjct: 8 LVDCHCHLSAPDFDHDLDDVLEKAKKASVMALVVVA 43 >gi|256369418|ref|YP_003106926.1| hydrolase, TatD family [Brucella microti CCM 4915] gi|255999578|gb|ACU47977.1| hydrolase, TatD family [Brucella microti CCM 4915] Length = 263 Score = 40.0 bits (92), Expect = 0.096, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML++ HCH DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 1 MLVDGHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 49 >gi|296101157|ref|YP_003611303.1| TatD-related deoxyribonuclease [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|295055616|gb|ADF60354.1| TatD-related deoxyribonuclease [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 260 Score = 40.0 bits (92), Expect = 0.097, Method: Compositional matrix adjust. Identities = 19/41 (46%), Positives = 23/41 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++THCHF P F D I RA QA + MI AI+V R Sbjct: 5 FVDTHCHFDFPPFTGDETQSIERAAQAGIHAMIVPAIEVDR 45 >gi|311265027|ref|XP_003130451.1| PREDICTED: putative deoxyribonuclease TATDN3-like [Sus scrofa] Length = 274 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ +A +A+V+ ++ +A Sbjct: 8 LVDCHCHLSAPDFDHDLDDVLEKAKKASVMALVVVA 43 >gi|189500705|ref|YP_001960175.1| hydrolase, TatD family [Chlorobium phaeobacteroides BS1] gi|189496146|gb|ACE04694.1| hydrolase, TatD family [Chlorobium phaeobacteroides BS1] Length = 263 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M ++ HCH P+FDEDR VI R + N+ +I Sbjct: 1 MFVDVHCHLSFPEFDEDRPEVIRRLREQNISLLI 34 >gi|239831996|ref|ZP_04680325.1| hydrolase, TatD family [Ochrobactrum intermedium LMG 3301] gi|239824263|gb|EEQ95831.1| hydrolase, TatD family [Ochrobactrum intermedium LMG 3301] Length = 264 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRV 41 >gi|310639498|ref|YP_003944256.1| hydrolase, tatd family [Paenibacillus polymyxa SC2] gi|309244448|gb|ADO54015.1| Hydrolase, TatD family [Paenibacillus polymyxa SC2] Length = 256 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L +TH H P FDEDR VI RA ++ V +MI I Sbjct: 3 LFDTHTHLDAPQFDEDREEVIARAVESGVTRMINIG 38 >gi|83954238|ref|ZP_00962958.1| hydrolase, TatD family protein [Sulfitobacter sp. NAS-14.1] gi|83841275|gb|EAP80445.1| hydrolase, TatD family protein [Sulfitobacter sp. NAS-14.1] Length = 272 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDFD + +VI RA A V +M+ I K+ Sbjct: 11 ITDSHCHLDFPDFDGELPDVIARAQAAGVTRMVTICTKL 49 >gi|83943049|ref|ZP_00955509.1| hydrolase, TatD family protein [Sulfitobacter sp. EE-36] gi|83846057|gb|EAP83934.1| hydrolase, TatD family protein [Sulfitobacter sp. EE-36] Length = 272 Score = 39.7 bits (91), Expect = 0.12, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDFD + +VI RA A V +M+ I K+ Sbjct: 11 ITDSHCHLDFPDFDGELPDVIARAQAAGVTRMVTICTKL 49 >gi|126307051|ref|XP_001374563.1| PREDICTED: similar to TatD DNase domain containing 3 [Monodelphis domestica] Length = 274 Score = 39.7 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 24/36 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ++ HCH DF+ D +V+ RA +ANVL ++A+A Sbjct: 8 FVDCHCHLSAADFNSDLEDVLERAKKANVLAIVAVA 43 >gi|221640131|ref|YP_002526393.1| hydrolase, TatD family [Rhodobacter sphaeroides KD131] gi|221160912|gb|ACM01892.1| Hydrolase, TatD family [Rhodobacter sphaeroides KD131] Length = 265 Score = 39.7 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++++HCH PDFD + +I RA A V +M+ I ++ Sbjct: 9 IVDSHCHLDFPDFDGEHEALIARARAAGVTRMVTICTRL 47 >gi|254420640|ref|ZP_05034364.1| hydrolase, TatD family [Brevundimonas sp. BAL3] gi|196186817|gb|EDX81793.1| hydrolase, TatD family [Brevundimonas sp. BAL3] Length = 260 Score = 39.7 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P FDEDR VI RA +A V M+ I+ K+ Sbjct: 1 MLIDSHVNLHAPQFDEDRDAVIARAREAGVGLMVEISDKL 40 >gi|308066861|ref|YP_003868466.1| Putative deoxyribonuclease yabD [Paenibacillus polymyxa E681] gi|305856140|gb|ADM67928.1| Putative deoxyribonuclease yabD [Paenibacillus polymyxa E681] Length = 256 Score = 39.7 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L +TH H P FDEDR VI RA ++ V +MI I Sbjct: 3 LFDTHTHLDAPQFDEDREEVIARAVESGVTRMINIG 38 >gi|77464247|ref|YP_353751.1| putative TatD-related deoxyribonuclease [Rhodobacter sphaeroides 2.4.1] gi|77388665|gb|ABA79850.1| putative TatD-related deoxyribonuclease [Rhodobacter sphaeroides 2.4.1] Length = 265 Score = 39.7 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++++HCH PDFD + +I RA A V +M+ I ++ Sbjct: 9 IVDSHCHLDFPDFDGEHEALIARARAAGVTRMVTICTRL 47 >gi|298291757|ref|YP_003693696.1| hydrolase, TatD family [Starkeya novella DSM 506] gi|296928268|gb|ADH89077.1| hydrolase, TatD family [Starkeya novella DSM 506] Length = 257 Score = 39.7 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 M++++HCH PDF + V+ RA A V +M+ I ++ R Sbjct: 1 MIVDSHCHLDFPDFAAELDAVVERARAAGVGRMVTIGTRIRR 42 >gi|260575559|ref|ZP_05843557.1| hydrolase, TatD family [Rhodobacter sp. SW2] gi|259022202|gb|EEW25500.1| hydrolase, TatD family [Rhodobacter sp. SW2] Length = 263 Score = 39.7 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 25/39 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++++HCH PDFD + +VI RA A V +M+ + ++ Sbjct: 7 IVDSHCHLDFPDFDNELPDVIARARAAGVTRMVTVCTRL 45 >gi|126463089|ref|YP_001044203.1| TatD family hydrolase [Rhodobacter sphaeroides ATCC 17029] gi|126104753|gb|ABN77431.1| hydrolase, TatD family [Rhodobacter sphaeroides ATCC 17029] Length = 265 Score = 39.7 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++++HCH PDFD + +I RA A V +M+ I ++ Sbjct: 9 IVDSHCHLDFPDFDGEHEALIARARAAGVTRMVTICTRL 47 >gi|304438287|ref|ZP_07398228.1| TatD family hydrolase [Selenomonas sp. oral taxon 149 str. 67H29BP] gi|304368653|gb|EFM22337.1| TatD family hydrolase [Selenomonas sp. oral taxon 149 str. 67H29BP] Length = 261 Score = 39.3 bits (90), Expect = 0.16, Method: Composition-based stats. Identities = 17/36 (47%), Positives = 24/36 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI+TH H FD+DR +VI RA +A V K+I++ Sbjct: 3 LIDTHAHLCDEKFDDDRSDVIARAREAGVTKIISMG 38 >gi|126729241|ref|ZP_01745055.1| hydrolase, TatD family protein [Sagittula stellata E-37] gi|126710231|gb|EBA09283.1| hydrolase, TatD family protein [Sagittula stellata E-37] Length = 273 Score = 39.3 bits (90), Expect = 0.16, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF + R VI RA A V +M+ I K+ Sbjct: 6 ITDSHCHLDFPDFSDSRPEVIARALDAGVHRMVTICTKL 44 >gi|319787346|ref|YP_004146821.1| hydrolase, TatD family [Pseudoxanthomonas suwonensis 11-1] gi|317465858|gb|ADV27590.1| hydrolase, TatD family [Pseudoxanthomonas suwonensis 11-1] Length = 264 Score = 39.3 bits (90), Expect = 0.16, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 24/37 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L+++HCH + +FD DR VI RA +A V + + AI Sbjct: 3 LVDSHCHLDVAEFDADRDAVIARAREAGVRRQVVPAI 39 >gi|254455166|ref|ZP_05068601.1| hydrolase, TatD family [Octadecabacter antarcticus 238] gi|198263576|gb|EDY87848.1| hydrolase, TatD family [Octadecabacter antarcticus 238] Length = 265 Score = 39.3 bits (90), Expect = 0.16, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 25/39 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++++HCH DFD +R +VI RA A V +M+ I ++ Sbjct: 6 IVDSHCHLDFSDFDAERADVIARAVDAGVTRMVTICTRL 44 >gi|154248250|ref|YP_001419208.1| TatD family hydrolase [Xanthobacter autotrophicus Py2] gi|154162335|gb|ABS69551.1| hydrolase, TatD family [Xanthobacter autotrophicus Py2] Length = 273 Score = 39.3 bits (90), Expect = 0.16, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF + +V+ RA A V ++ I+ +V R Sbjct: 14 MLVDSHCHLDFPDFAAELPDVVARAGAAGVSHLVTISTRVRR 55 >gi|206580529|ref|YP_002240569.1| hydrolase, TatD family [Klebsiella pneumoniae 342] gi|288937265|ref|YP_003441324.1| TatD-related deoxyribonuclease [Klebsiella variicola At-22] gi|206569587|gb|ACI11363.1| hydrolase, TatD family [Klebsiella pneumoniae 342] gi|288891974|gb|ADC60292.1| TatD-related deoxyribonuclease [Klebsiella variicola At-22] Length = 261 Score = 39.3 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 19/41 (46%), Positives = 23/41 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F ED + RA QA V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAEDETASLARAAQAGVGQIIVPAISAAR 45 >gi|84516818|ref|ZP_01004176.1| hydrolase, TatD family [Loktanella vestfoldensis SKA53] gi|84509286|gb|EAQ05745.1| hydrolase, TatD family [Loktanella vestfoldensis SKA53] Length = 267 Score = 39.3 bits (90), Expect = 0.18, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF+ +R VI RA A V +M+ I K+ Sbjct: 11 ITDSHCHLDFPDFEGERDAVIARALAAGVTRMVTICTKL 49 >gi|323699421|ref|ZP_08111333.1| hydrolase, TatD family [Desulfovibrio sp. ND132] gi|323459353|gb|EGB15218.1| hydrolase, TatD family [Desulfovibrio desulfuricans ND132] Length = 272 Score = 39.3 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 +++H H L DFDEDR +I RAH + V +++ + Sbjct: 19 VDSHAHLDLEDFDEDREEIIARAHASGVSRIVNV 52 >gi|259415016|ref|ZP_05738938.1| hydrolase, TatD family [Silicibacter sp. TrichCH4B] gi|259348926|gb|EEW60680.1| hydrolase, TatD family [Silicibacter sp. TrichCH4B] Length = 267 Score = 39.3 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDFD + V+ RA +A V +M+ I K+ Sbjct: 6 ITDSHCHLDFPDFDGELPEVLARAAEAGVTRMVTICTKL 44 >gi|254706808|ref|ZP_05168636.1| SEC-independent protein TATD [Brucella pinnipedialis M163/99/10] Length = 263 Score = 39.3 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HC+ DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 1 MLVDSHCYLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 49 >gi|241662662|ref|YP_002981022.1| TatD-like deoxyribonuclease [Ralstonia pickettii 12D] gi|240864689|gb|ACS62350.1| TatD-related deoxyribonuclease [Ralstonia pickettii 12D] Length = 270 Score = 39.3 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 23/38 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH DFD DR V+ +AH A V ++ A+ Sbjct: 1 MWIDTHCHLDASDFDADRDAVVAQAHAAGVNHIVVPAV 38 >gi|301058387|ref|ZP_07199409.1| hydrolase, TatD family [delta proteobacterium NaphS2] gi|300447510|gb|EFK11253.1| hydrolase, TatD family [delta proteobacterium NaphS2] Length = 251 Score = 39.3 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 23/35 (65%) Query: 6 HCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 HCH + DFD+DR VI RA + + +M++I I + Sbjct: 1 HCHLDMKDFDKDREAVIERARREGIGRMVSIGIDL 35 >gi|261314275|ref|ZP_05953472.1| hydrolase [Brucella pinnipedialis M163/99/10] gi|261303301|gb|EEY06798.1| hydrolase [Brucella pinnipedialis M163/99/10] Length = 264 Score = 39.3 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV-----IRTL 44 ML+++HC+ DF+ +R V+ RA A + +M+ I+ +V IRTL Sbjct: 2 MLVDSHCYLDFADFEPERDAVVQRALDAGIKRMVTISTRVRKFDAIRTL 50 >gi|187928055|ref|YP_001898542.1| TatD-related deoxyribonuclease [Ralstonia pickettii 12J] gi|187724945|gb|ACD26110.1| TatD-related deoxyribonuclease [Ralstonia pickettii 12J] Length = 270 Score = 39.3 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 23/38 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH DFD DR V+ +AH A V ++ A+ Sbjct: 1 MWIDTHCHLDASDFDADRDAVVAQAHAAGVNHIVVPAV 38 >gi|119384878|ref|YP_915934.1| TatD family hydrolase [Paracoccus denitrificans PD1222] gi|119374645|gb|ABL70238.1| hydrolase, TatD family [Paracoccus denitrificans PD1222] Length = 265 Score = 39.3 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +L+++HCH PDF+ ++ ++ RA A V +M+ I ++ Sbjct: 8 LLVDSHCHLDFPDFEGEQAELVARARAAGVTRMVTICTRL 47 >gi|296445797|ref|ZP_06887749.1| hydrolase, TatD family [Methylosinus trichosporium OB3b] gi|296256625|gb|EFH03700.1| hydrolase, TatD family [Methylosinus trichosporium OB3b] Length = 281 Score = 38.9 bits (89), Expect = 0.21, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 22/40 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH PDF ++ VI R V + I I+ V Sbjct: 1 MLIDTHCHLDFPDFAPEQDEVIARGRAQGVARFITISTHV 40 >gi|158423802|ref|YP_001525094.1| TatD-related deoxyribonuclease [Azorhizobium caulinodans ORS 571] gi|158330691|dbj|BAF88176.1| TatD-related deoxyribonuclease [Azorhizobium caulinodans ORS 571] Length = 259 Score = 38.9 bits (89), Expect = 0.21, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF + +V+ RA A V ++ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAAELPDVVARAKAAGVSHLVTISTRVRR 42 >gi|84623062|ref|YP_450434.1| hypothetical protein XOO_1405 [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|84367002|dbj|BAE68160.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF 311018] Length = 255 Score = 38.9 bits (89), Expect = 0.21, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH +FD DR VI RA A V++ + AI Sbjct: 3 LIDSHCHLDAGEFDHDRATVIARAQAAGVIQQVLPAI 39 >gi|21227387|ref|NP_633309.1| Sec-independent transport protein TatD [Methanosarcina mazei Go1] gi|20905749|gb|AAM30981.1| Sec-independent transport protein TatD [Methanosarcina mazei Go1] Length = 257 Score = 38.9 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I++HCH P F+ DR I RA +A V+ M+ I + Sbjct: 10 IIDSHCHLDFPKFNPDREEAIQRARKAGVVGMVNSGISL 48 >gi|294665661|ref|ZP_06730937.1| TatD related DNase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] gi|292604556|gb|EFF47931.1| TatD related DNase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] Length = 255 Score = 38.9 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH +FD DR VI RA A V++ + AI Sbjct: 3 LIDSHCHLDAGEFDHDRATVIARAQAAGVVQQVVPAI 39 >gi|78186369|ref|YP_374412.1| TatD-related deoxyribonuclease [Chlorobium luteolum DSM 273] gi|78166271|gb|ABB23369.1| Sec-independent protein translocase TatD [Chlorobium luteolum DSM 273] Length = 256 Score = 38.9 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ML + HCH P+FD DR VI R A V +I Sbjct: 1 MLADAHCHLSFPEFDPDRQEVIQRMQAAGVTLLI 34 >gi|188575648|ref|YP_001912577.1| putative deoxyribonuclease YjjV [Xanthomonas oryzae pv. oryzae PXO99A] gi|188520100|gb|ACD58045.1| putative deoxyribonuclease YjjV [Xanthomonas oryzae pv. oryzae PXO99A] Length = 255 Score = 38.9 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH +FD DR VI RA A V++ + AI Sbjct: 3 LIDSHCHLDAGEFDHDRATVIARAQAAGVIQQVLPAI 39 >gi|46202671|ref|ZP_00208610.1| COG0084: Mg-dependent DNase [Magnetospirillum magnetotacticum MS-1] Length = 259 Score = 38.9 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 24/42 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D V+ RA A V ++ I V R Sbjct: 1 MLVDSHCHLDFPDFADDLDGVVGRAKAAGVGVLLTIGTHVTR 42 >gi|144899822|emb|CAM76686.1| TatD-related deoxyribonuclease [Magnetospirillum gryphiswaldense MSR-1] Length = 258 Score = 38.9 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF ++ V+ RA Q+ + M+ I V R Sbjct: 1 MLVDSHCHLDFPDFADELDQVVERARQSGIGLMLTINTHVSR 42 >gi|254436736|ref|ZP_05050230.1| hydrolase, TatD family [Octadecabacter antarcticus 307] gi|198252182|gb|EDY76496.1| hydrolase, TatD family [Octadecabacter antarcticus 307] Length = 274 Score = 38.9 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 25/39 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++++HCH DFD +R +VI RA A V +M+ I ++ Sbjct: 15 IVDSHCHLDFADFDAERADVIGRAVDAGVSRMVTICTRL 53 >gi|166712676|ref|ZP_02243883.1| hypothetical protein Xoryp_14785 [Xanthomonas oryzae pv. oryzicola BLS256] Length = 255 Score = 38.5 bits (88), Expect = 0.27, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH +FD DR VI RA A V++ + AI Sbjct: 3 LIDSHCHLDAGEFDHDRATVIARAQAAGVIQQVLPAI 39 >gi|58581137|ref|YP_200153.1| hypothetical protein XOO1514 [Xanthomonas oryzae pv. oryzae KACC10331] gi|58425731|gb|AAW74768.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae KACC10331] Length = 255 Score = 38.5 bits (88), Expect = 0.27, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH +FD DR VI RA A V++ + AI Sbjct: 3 LIDSHCHLDAGEFDHDRATVIARAQAAGVIQQVLPAI 39 >gi|146305818|ref|YP_001186283.1| TatD family hydrolase [Pseudomonas mendocina ymp] gi|145574019|gb|ABP83551.1| hydrolase, TatD family [Pseudomonas mendocina ymp] Length = 259 Score = 38.5 bits (88), Expect = 0.28, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 22/37 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ R+ V +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRDEVLARSRALGVQRMVVLGV 39 >gi|325914005|ref|ZP_08176361.1| Mg-dependent DNase [Xanthomonas vesicatoria ATCC 35937] gi|325539774|gb|EGD11414.1| Mg-dependent DNase [Xanthomonas vesicatoria ATCC 35937] Length = 255 Score = 38.5 bits (88), Expect = 0.28, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 24/37 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH +FD DR VI RA +A V++ + A+ Sbjct: 3 LIDSHCHLDAGEFDHDRPAVIARAREAGVVQQVVPAV 39 >gi|126726753|ref|ZP_01742593.1| hydrolase, TatD family protein [Rhodobacterales bacterium HTCC2150] gi|126704082|gb|EBA03175.1| hydrolase, TatD family protein [Rhodobacterales bacterium HTCC2150] Length = 261 Score = 38.5 bits (88), Expect = 0.28, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++++HCH PDFD + +I RA A V +M+ I ++ Sbjct: 5 IVDSHCHLDFPDFDGEHEALIARAEAAGVKRMVTICTQL 43 >gi|83593035|ref|YP_426787.1| TatD-related deoxyribonuclease [Rhodospirillum rubrum ATCC 11170] gi|83575949|gb|ABC22500.1| TatD-related deoxyribonuclease [Rhodospirillum rubrum ATCC 11170] Length = 270 Score = 38.5 bits (88), Expect = 0.28, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 23/42 (54%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 M++++HCH PDF D V+ RA A V M+ I V R Sbjct: 1 MIVDSHCHLDFPDFAPDIDAVVERARTAGVGTMLTICTHVSR 42 >gi|146276607|ref|YP_001166766.1| TatD family hydrolase [Rhodobacter sphaeroides ATCC 17025] gi|145554848|gb|ABP69461.1| hydrolase, TatD family [Rhodobacter sphaeroides ATCC 17025] Length = 265 Score = 38.5 bits (88), Expect = 0.29, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++++HCH PDFD + +I RA A V +M+ I ++ Sbjct: 9 IVDSHCHLDFPDFDGEHAALIERARAAGVTRMVTICTRL 47 >gi|116751044|ref|YP_847731.1| TatD family hydrolase [Syntrophobacter fumaroxidans MPOB] gi|116700108|gb|ABK19296.1| hydrolase, TatD family [Syntrophobacter fumaroxidans MPOB] Length = 264 Score = 38.5 bits (88), Expect = 0.30, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+TH H P+F +D V+ RA +A+V K+I I I + Sbjct: 1 MLIDTHAHLDFPEFAQDLPAVLERAAKADVRKIITIGISL 40 >gi|83311546|ref|YP_421810.1| Mg-dependent DNase [Magnetospirillum magneticum AMB-1] gi|82946387|dbj|BAE51251.1| Mg-dependent DNase [Magnetospirillum magneticum AMB-1] Length = 259 Score = 38.5 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 24/42 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D V+ RA A V ++ I V R Sbjct: 1 MLVDSHCHLDFPDFADDLDGVVGRAGAAGVGVLLTIGTHVTR 42 >gi|269837325|ref|YP_003319553.1| hydrolase, TatD family [Sphaerobacter thermophilus DSM 20745] gi|269786588|gb|ACZ38731.1| hydrolase, TatD family [Sphaerobacter thermophilus DSM 20745] Length = 261 Score = 38.5 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 23/36 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++THCH L FDEDR V+ RA + V +++ + Sbjct: 3 LVDTHCHLDLEAFDEDRAQVLARARASGVERILVVG 38 >gi|159043472|ref|YP_001532266.1| hydrolase [Dinoroseobacter shibae DFL 12] gi|157911232|gb|ABV92665.1| hydrolase [Dinoroseobacter shibae DFL 12] Length = 269 Score = 38.1 bits (87), Expect = 0.35, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 22/39 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 L+++HCH PDF E + RA A V +M+ I K+ Sbjct: 6 LVDSHCHLDFPDFAETLPETVARAQAAGVARMVTICTKL 44 >gi|307729225|ref|YP_003906449.1| TatD-related deoxyribonuclease [Burkholderia sp. CCGE1003] gi|307583760|gb|ADN57158.1| TatD-related deoxyribonuclease [Burkholderia sp. CCGE1003] Length = 262 Score = 38.1 bits (87), Expect = 0.36, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 24/38 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR +V AH+A V +++ AI Sbjct: 1 MWIDTHCHLDASEFDADREHVAAAAHRAGVGRIVIPAI 38 >gi|20093397|ref|NP_619472.1| membrane targeting/translocation system protein [Methanosarcina acetivorans C2A] gi|19918767|gb|AAM07952.1| membrane targeting/translocation system protein [Methanosarcina acetivorans C2A] Length = 252 Score = 38.1 bits (87), Expect = 0.37, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I++HCH P F+ DR I RA +A V+ M+ I + Sbjct: 5 IIDSHCHLDFPKFNPDREEAIHRARKAGVVGMVNSGISL 43 >gi|121601870|ref|YP_989108.1| TatD family hydrolase [Bartonella bacilliformis KC583] gi|120614047|gb|ABM44648.1| hydrolase, TatD family [Bartonella bacilliformis KC583] Length = 257 Score = 38.1 bits (87), Expect = 0.37, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 25/40 (62%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF +D VI RA +++ +MI I+ V Sbjct: 1 MLIDTHCHLDFEDFAQDLDGVIQRALTSDIGRMITISTYV 40 >gi|37524525|ref|NP_927869.1| hypothetical protein plu0517 [Photorhabdus luminescens subsp. laumondii TTO1] gi|36783949|emb|CAE12812.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] Length = 257 Score = 38.1 bits (87), Expect = 0.39, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCHF P F +D + RA Q V ++I AI Sbjct: 1 MFIDTHCHFDFPPFRDDEQQSLQRAAQVGVDRIIVPAI 38 >gi|260590833|ref|ZP_05856291.1| deoxyribonuclease, TatD family [Prevotella veroralis F0319] gi|260537184|gb|EEX19801.1| deoxyribonuclease, TatD family [Prevotella veroralis F0319] Length = 283 Score = 38.1 bits (87), Expect = 0.39, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 22/33 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 M+I+TH H + DF ED VIMRA +A V K+ Sbjct: 1 MIIDTHAHLDVEDFSEDLSEVIMRAKEAGVGKI 33 >gi|254510459|ref|ZP_05122526.1| hydrolase, TatD family [Rhodobacteraceae bacterium KLH11] gi|221534170|gb|EEE37158.1| hydrolase, TatD family [Rhodobacteraceae bacterium KLH11] Length = 268 Score = 38.1 bits (87), Expect = 0.40, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDFD ++ RA +A V +M+ I K+ Sbjct: 7 ITDSHCHLDFPDFDGQLDEIVARATEAGVTRMVTICTKL 45 >gi|193213293|ref|YP_001999246.1| hydrolase, TatD family [Chlorobaculum parvum NCIB 8327] gi|193086770|gb|ACF12046.1| hydrolase, TatD family [Chlorobaculum parvum NCIB 8327] Length = 259 Score = 38.1 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 18/29 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANV 30 L + HCH P+FDEDR VI R +A V Sbjct: 6 LADIHCHLSFPEFDEDREQVIERLREAGV 34 >gi|288802128|ref|ZP_06407569.1| hydrolase [Prevotella melaninogenica D18] gi|288335563|gb|EFC73997.1| hydrolase [Prevotella melaninogenica D18] Length = 270 Score = 37.7 bits (86), Expect = 0.47, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI--AIAIKVIRTLF 45 M+I+TH H + DF +D VI RAH+A V K+ AI +K + T+ Sbjct: 1 MIIDTHAHLDVEDFADDLPEVISRAHEAGVGKIFLPAIDLKSVDTVL 47 >gi|308050570|ref|YP_003914136.1| TatD-related deoxyribonuclease [Ferrimonas balearica DSM 9799] gi|307632760|gb|ADN77062.1| TatD-related deoxyribonuclease [Ferrimonas balearica DSM 9799] Length = 259 Score = 37.7 bits (86), Expect = 0.49, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 25/38 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 +LI++HCH LP F DR V+ RAH+A V ++ A+ Sbjct: 3 VLIDSHCHLDLPAFCGDRDAVLQRAHKAGVGAIMVPAV 40 >gi|312173618|emb|CBX81872.1| Mg-dependent DNase [Erwinia amylovora ATCC BAA-2158] Length = 258 Score = 37.7 bits (86), Expect = 0.51, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ++THCHF P F D + RA QA V K+IA+++ Sbjct: 5 FVDTHCHFDFPPFVGDEQASLQRAAQAGVEKIIAVSV 41 >gi|319898929|ref|YP_004159022.1| deoxyribonuclease [Bartonella clarridgeiae 73] gi|319402893|emb|CBI76444.1| putative deoxyribonuclease [Bartonella clarridgeiae 73] Length = 256 Score = 37.7 bits (86), Expect = 0.52, Method: Compositional matrix adjust. Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH DF +D + +I RA ANV +MI I+ V Sbjct: 1 MLIDTHCHLNFEDF-QDLNGIIQRALAANVERMITISTHV 39 >gi|213582898|ref|ZP_03364724.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664] Length = 61 Score = 37.7 bits (86), Expect = 0.53, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 21/39 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEA 43 >gi|261339028|ref|ZP_05966886.1| hypothetical protein ENTCAN_05237 [Enterobacter cancerogenus ATCC 35316] gi|288318863|gb|EFC57801.1| hydrogenase nickel insertion protein HypA [Enterobacter cancerogenus ATCC 35316] Length = 260 Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 18/39 (46%), Positives = 22/39 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 I+THCHF P F D + I RA QA V +I AI+ Sbjct: 5 FIDTHCHFDFPPFTGDETHSIARAAQAGVGAIIVPAIEA 43 >gi|292489451|ref|YP_003532338.1| mg-dependent DNase [Erwinia amylovora CFBP1430] gi|292898335|ref|YP_003537704.1| TatD related DNase [Erwinia amylovora ATCC 49946] gi|291198183|emb|CBJ45289.1| TatD related DNase [Erwinia amylovora ATCC 49946] gi|291554885|emb|CBA22800.1| Mg-dependent DNase [Erwinia amylovora CFBP1430] Length = 258 Score = 37.7 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ++THCHF P F D + RA QA V K+IA+++ Sbjct: 5 FVDTHCHFDFPPFVGDEQASLQRAAQAGVEKIIAVSV 41 >gi|114770994|ref|ZP_01448434.1| hydrolase, TatD family protein [alpha proteobacterium HTCC2255] gi|114548276|gb|EAU51162.1| hydrolase, TatD family protein [alpha proteobacterium HTCC2255] Length = 262 Score = 37.7 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 27/40 (67%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +++++HCH PDF+ + +++ RA+ A V +M+ I K+ Sbjct: 5 IIVDSHCHLDFPDFEGEIPDLVARANDAGVKRMVTICTKL 44 >gi|83814681|ref|YP_445423.1| TatD family hydrolase [Salinibacter ruber DSM 13855] gi|294507305|ref|YP_003571363.1| TatD related DNase [Salinibacter ruber M8] gi|83756075|gb|ABC44188.1| hydrolase, TatD family [Salinibacter ruber DSM 13855] gi|294343633|emb|CBH24411.1| TatD related DNase [Salinibacter ruber M8] Length = 262 Score = 37.7 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M+I+TH H L FDEDR V+ RA A V ++ AI V Sbjct: 1 MIIDTHAHLYLDQFDEDRDAVLRRAWGAEVDVVVMPAIDV 40 >gi|290512669|ref|ZP_06552035.1| Mg-dependent DNase [Klebsiella sp. 1_1_55] gi|289775010|gb|EFD83012.1| Mg-dependent DNase [Klebsiella sp. 1_1_55] Length = 261 Score = 37.7 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F ED + RA Q V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAEDETASLARAAQVGVGQIIVPAISAAR 45 >gi|124268244|ref|YP_001022248.1| putative TatD related DNase [Methylibium petroleiphilum PM1] gi|124261019|gb|ABM96013.1| putative TatD related DNase [Methylibium petroleiphilum PM1] Length = 284 Score = 37.7 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 +THCH P+FD DR V+ RA A V +++ A+ Sbjct: 12 DTHCHLDAPEFDADRTAVVERARHAGVTQIVLPAV 46 >gi|332112100|gb|EGJ12076.1| putative TatD related DNase [Rubrivivax benzoatilyticus JA2] Length = 270 Score = 37.4 bits (85), Expect = 0.62, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH +FD DR V+ RA A V+ + A++ Sbjct: 1 MWIDTHCHLDAAEFDADRDAVVARARSAGVVMQVIPAVE 39 >gi|99078564|ref|YP_611822.1| TatD-related deoxyribonuclease [Ruegeria sp. TM1040] gi|99035702|gb|ABF62560.1| TatD-related deoxyribonuclease [Ruegeria sp. TM1040] Length = 267 Score = 37.4 bits (85), Expect = 0.65, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF+ + V+ RA +A V +M+ I K+ Sbjct: 6 ITDSHCHLDFPDFEGELPEVLARAAEAGVTRMVTICTKL 44 >gi|90417682|ref|ZP_01225594.1| hydrolase, TatD family [Aurantimonas manganoxydans SI85-9A1] gi|90337354|gb|EAS51005.1| hydrolase, TatD family [Aurantimonas manganoxydans SI85-9A1] Length = 264 Score = 37.4 bits (85), Expect = 0.68, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L+++HCH PDF EDR ++I RA V + I+ Sbjct: 4 LVDSHCHLDFPDFAEDRADLIARAKAEGVGLFVTIS 39 >gi|281421200|ref|ZP_06252199.1| putative hydrolase [Prevotella copri DSM 18205] gi|281404735|gb|EFB35415.1| putative hydrolase [Prevotella copri DSM 18205] Length = 279 Score = 37.4 bits (85), Expect = 0.72, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 24/42 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 +I+TH HF +FDEDR RA +A V K+ AI V T Sbjct: 4 VIDTHTHFDAEEFDEDRAEAFARAKEAGVGKVFLPAIDVKTT 45 >gi|256025297|ref|ZP_05439162.1| putative deoxyribonuclease YjjV [Escherichia sp. 4_1_40B] Length = 259 Score = 37.4 bits (85), Expect = 0.72, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAEQAGVGKIIVPATE 42 >gi|315499860|ref|YP_004088663.1| hydrolase, tatd family [Asticcacaulis excentricus CB 48] gi|315417872|gb|ADU14512.1| hydrolase, TatD family [Asticcacaulis excentricus CB 48] Length = 258 Score = 37.4 bits (85), Expect = 0.75, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 25/40 (62%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P +DEDR VI RA +A V M+ I +V Sbjct: 1 MLIDSHVNLHAPQYDEDRDAVIDRAREAGVGLMVNICDRV 40 >gi|163743052|ref|ZP_02150435.1| hydrolase, TatD family protein [Phaeobacter gallaeciensis 2.10] gi|161383735|gb|EDQ08121.1| hydrolase, TatD family protein [Phaeobacter gallaeciensis 2.10] Length = 266 Score = 37.0 bits (84), Expect = 0.78, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF+ + +I RA +A V +M+ I K+ Sbjct: 5 ITDSHCHLDFPDFEGELDALITRAAEAGVTRMVTICTKL 43 >gi|260459473|ref|ZP_05807728.1| hydrolase, TatD family [Mesorhizobium opportunistum WSM2075] gi|259035027|gb|EEW36283.1| hydrolase, TatD family [Mesorhizobium opportunistum WSM2075] Length = 264 Score = 37.0 bits (84), Expect = 0.80, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF E+R ++ RA A + +M+ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAEERAAIVARAKAAGIGRMVTISTRVKR 42 >gi|254475640|ref|ZP_05089026.1| TatD related DNase [Ruegeria sp. R11] gi|214029883|gb|EEB70718.1| TatD related DNase [Ruegeria sp. R11] Length = 273 Score = 37.0 bits (84), Expect = 0.80, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF+ + +I RA +A V +M+ I K+ Sbjct: 12 ITDSHCHLDFPDFEGELDALIARAAEAGVTRMVTICTKL 50 >gi|260803116|ref|XP_002596437.1| hypothetical protein BRAFLDRAFT_77148 [Branchiostoma floridae] gi|229281693|gb|EEN52449.1| hypothetical protein BRAFLDRAFT_77148 [Branchiostoma floridae] Length = 264 Score = 37.0 bits (84), Expect = 0.80, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I+ HCH +FDED VI RA +A + ++A+A Sbjct: 5 IDCHCHLSAEEFDEDLDEVITRAKEAGIGAIVAVA 39 >gi|126739766|ref|ZP_01755457.1| hydrolase, TatD family protein [Roseobacter sp. SK209-2-6] gi|126718998|gb|EBA15709.1| hydrolase, TatD family protein [Roseobacter sp. SK209-2-6] Length = 277 Score = 37.0 bits (84), Expect = 0.80, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF+ ++ RA +A V +M+ I K+ Sbjct: 16 ITDSHCHLDFPDFEGQLDEIVTRAAEAGVTRMVTICTKL 54 >gi|253987974|ref|YP_003039330.1| hypothetical protein PAU_00493 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] gi|253779424|emb|CAQ82585.1| conserved hypothetical protein [Photorhabdus asymbiotica] Length = 257 Score = 37.0 bits (84), Expect = 0.81, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCHF P F +D + +A Q V K+I A+ Sbjct: 1 MFIDTHCHFDFPPFCDDERQSLQQAAQVGVDKIIVPAV 38 >gi|194337098|ref|YP_002018892.1| hydrolase, TatD family [Pelodictyon phaeoclathratiforme BU-1] gi|194309575|gb|ACF44275.1| hydrolase, TatD family [Pelodictyon phaeoclathratiforme BU-1] Length = 257 Score = 37.0 bits (84), Expect = 0.81, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 22/40 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M ++ HCH P+FDEDR VI R + + +I + V Sbjct: 1 MFVDIHCHLSFPEFDEDRDEVIKRLKEEGIGLLIDPGVDV 40 >gi|163738561|ref|ZP_02145975.1| hydrolase, TatD family protein [Phaeobacter gallaeciensis BS107] gi|161387889|gb|EDQ12244.1| hydrolase, TatD family protein [Phaeobacter gallaeciensis BS107] Length = 266 Score = 37.0 bits (84), Expect = 0.83, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF+ + +I RA +A V +M+ I K+ Sbjct: 5 ITDSHCHLDFPDFEGELDALIARAAEAGVTRMVTICTKL 43 >gi|114565625|ref|YP_752779.1| TatD family hydrolase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] gi|114336560|gb|ABI67408.1| hydrolase, TatD family [Syntrophomonas wolfei subsp. wolfei str. Goettingen] Length = 256 Score = 37.0 bits (84), Expect = 0.83, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 23/37 (62%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H P F++DR ++ RA A + K+I I Sbjct: 1 MLIDTHAHLQDPAFNQDRKEIMQRAKTAGLEKIICIG 37 >gi|254485854|ref|ZP_05099059.1| putative deoxyribonuclease YcfH [Roseobacter sp. GAI101] gi|214042723|gb|EEB83361.1| putative deoxyribonuclease YcfH [Roseobacter sp. GAI101] Length = 268 Score = 37.0 bits (84), Expect = 0.84, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF ++ +VI RA A V +M+ I K+ Sbjct: 7 ITDSHCHLDFPDFQDELPDVIDRATAAGVTRMVTICTKL 45 >gi|160901542|ref|YP_001567123.1| TatD family hydrolase [Petrotoga mobilis SJ95] gi|160359186|gb|ABX30800.1| hydrolase, TatD family [Petrotoga mobilis SJ95] Length = 255 Score = 37.0 bits (84), Expect = 0.84, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 I+THCH LL FD+DR ++ +A++ L +I I I V Sbjct: 3 FIDTHCHLLLKQFDDDRQEMLKKANEELDL-LIEIGINV 40 >gi|295689511|ref|YP_003593204.1| hydrolase, TatD family [Caulobacter segnis ATCC 21756] gi|295431414|gb|ADG10586.1| hydrolase, TatD family [Caulobacter segnis ATCC 21756] Length = 259 Score = 37.0 bits (84), Expect = 0.85, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P F ED+ VI RA +A + M+ I KV Sbjct: 1 MLIDSHVNLHAPQFAEDKDAVIARAREAGIAMMVTICDKV 40 >gi|300023245|ref|YP_003755856.1| hydrolase, TatD family [Hyphomicrobium denitrificans ATCC 51888] gi|299525066|gb|ADJ23535.1| hydrolase, TatD family [Hyphomicrobium denitrificans ATCC 51888] Length = 269 Score = 37.0 bits (84), Expect = 0.85, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML++ HCH P+F + V+ RA +A V M+ I+ ++ Sbjct: 1 MLVDHHCHLDFPEFAPELDQVVARAREAGVGTMVTISTRI 40 >gi|213027246|ref|ZP_03341693.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] Length = 125 Score = 37.0 bits (84), Expect = 0.85, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 21/39 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEA 43 >gi|323975863|gb|EGB70959.1| TatD family protein hydrolase [Escherichia coli TW10509] Length = 260 Score = 37.0 bits (84), Expect = 0.86, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|323964780|gb|EGB60248.1| TatD family protein hydrolase [Escherichia coli M863] gi|327250001|gb|EGE61731.1| hypothetical protein ECSTEC7V_5163 [Escherichia coli STEC_7v] Length = 260 Score = 37.0 bits (84), Expect = 0.86, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|309704887|emb|CBJ04240.1| putative deoxyribonuclease [Escherichia coli ETEC H10407] Length = 260 Score = 37.0 bits (84), Expect = 0.86, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|300918462|ref|ZP_07135059.1| hydrolase, TatD family [Escherichia coli MS 115-1] gi|300946762|ref|ZP_07161010.1| hydrolase, TatD family [Escherichia coli MS 116-1] gi|300959106|ref|ZP_07171192.1| hydrolase, TatD family [Escherichia coli MS 175-1] gi|284924557|emb|CBG37696.1| putative deoxyribonuclease [Escherichia coli 042] gi|300314254|gb|EFJ64038.1| hydrolase, TatD family [Escherichia coli MS 175-1] gi|300414385|gb|EFJ97695.1| hydrolase, TatD family [Escherichia coli MS 115-1] gi|300453586|gb|EFK17206.1| hydrolase, TatD family [Escherichia coli MS 116-1] gi|315616254|gb|EFU96873.1| uncharacterized deoxyribonuclease yjjV [Escherichia coli 3431] gi|323960152|gb|EGB55796.1| TatD family protein hydrolase [Escherichia coli H489] Length = 260 Score = 37.0 bits (84), Expect = 0.86, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|157163826|ref|YP_001461144.1| putative deoxyribonuclease YjjV [Escherichia coli HS] gi|157069506|gb|ABV08761.1| hydrolase, TatD family [Escherichia coli HS] Length = 260 Score = 37.0 bits (84), Expect = 0.86, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|187732308|ref|YP_001883041.1| putative deoxyribonuclease YjjV [Shigella boydii CDC 3083-94] gi|187429300|gb|ACD08574.1| hydrolase, TatD family [Shigella boydii CDC 3083-94] gi|320176882|gb|EFW51910.1| putative deoxyribonuclease YjjV [Shigella dysenteriae CDC 74-1112] Length = 260 Score = 37.0 bits (84), Expect = 0.87, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|170021662|ref|YP_001726616.1| putative deoxyribonuclease YjjV [Escherichia coli ATCC 8739] gi|193070599|ref|ZP_03051537.1| hydrolase, TatD family [Escherichia coli E110019] gi|254037389|ref|ZP_04871466.1| hydrolase [Escherichia sp. 1_1_43] gi|260858553|ref|YP_003232444.1| putative DNase [Escherichia coli O26:H11 str. 11368] gi|300905365|ref|ZP_07123135.1| hydrolase, TatD family [Escherichia coli MS 84-1] gi|300928483|ref|ZP_07144010.1| hydrolase, TatD family [Escherichia coli MS 187-1] gi|301022281|ref|ZP_07186179.1| hydrolase, TatD family [Escherichia coli MS 196-1] gi|301303479|ref|ZP_07209602.1| hydrolase, TatD family [Escherichia coli MS 124-1] gi|307313687|ref|ZP_07593306.1| TatD-related deoxyribonuclease [Escherichia coli W] gi|169756590|gb|ACA79289.1| TatD-related deoxyribonuclease [Escherichia coli ATCC 8739] gi|192956082|gb|EDV86547.1| hydrolase, TatD family [Escherichia coli E110019] gi|226840495|gb|EEH72497.1| hydrolase [Escherichia sp. 1_1_43] gi|257757202|dbj|BAI28704.1| predicted DNase [Escherichia coli O26:H11 str. 11368] gi|299881331|gb|EFI89542.1| hydrolase, TatD family [Escherichia coli MS 196-1] gi|300402774|gb|EFJ86312.1| hydrolase, TatD family [Escherichia coli MS 84-1] gi|300463518|gb|EFK27011.1| hydrolase, TatD family [Escherichia coli MS 187-1] gi|300841206|gb|EFK68966.1| hydrolase, TatD family [Escherichia coli MS 124-1] gi|306906510|gb|EFN37023.1| TatD-related deoxyribonuclease [Escherichia coli W] gi|315063681|gb|ADT78008.1| predicted DNase [Escherichia coli W] gi|315255763|gb|EFU35731.1| hydrolase, TatD family [Escherichia coli MS 85-1] gi|320200506|gb|EFW75092.1| Putative deoxyribonuclease YjjV [Escherichia coli EC4100B] gi|323157734|gb|EFZ43839.1| hypothetical protein ECEPECA14_0428 [Escherichia coli EPECa14] gi|323171390|gb|EFZ57037.1| hypothetical protein ECLT68_4033 [Escherichia coli LT-68] gi|323380238|gb|ADX52506.1| TatD-related deoxyribonuclease [Escherichia coli KO11] gi|323935221|gb|EGB31581.1| TatD family protein hydrolase [Escherichia coli E1520] gi|324118332|gb|EGC12226.1| TatD family protein hydrolase [Escherichia coli E1167] Length = 260 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|300816003|ref|ZP_07096226.1| hydrolase, TatD family [Escherichia coli MS 107-1] gi|300531210|gb|EFK52272.1| hydrolase, TatD family [Escherichia coli MS 107-1] gi|323181918|gb|EFZ67330.1| hypothetical protein ECOK1357_4789 [Escherichia coli 1357] Length = 260 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|300923510|ref|ZP_07139546.1| hydrolase, TatD family [Escherichia coli MS 182-1] gi|300420221|gb|EFK03532.1| hydrolase, TatD family [Escherichia coli MS 182-1] Length = 260 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|293476642|ref|ZP_06665050.1| Mg-dependent DNase [Escherichia coli B088] gi|291321095|gb|EFE60537.1| Mg-dependent DNase [Escherichia coli B088] Length = 260 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|237704115|ref|ZP_04534596.1| hydrolase [Escherichia sp. 3_2_53FAA] gi|226902027|gb|EEH88286.1| hydrolase [Escherichia sp. 3_2_53FAA] gi|315284955|gb|EFU44400.1| hydrolase, TatD family [Escherichia coli MS 110-3] gi|323939805|gb|EGB36007.1| TatD family protein hydrolase [Escherichia coli E482] gi|323955334|gb|EGB51106.1| TatD family protein hydrolase [Escherichia coli H263] Length = 260 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|218556913|ref|YP_002389827.1| putative deoxyribonuclease YjjV [Escherichia coli IAI1] gi|218363682|emb|CAR01341.1| putative DNase [Escherichia coli IAI1] gi|323945792|gb|EGB41838.1| TatD family protein hydrolase [Escherichia coli H120] Length = 260 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|209921844|ref|YP_002295928.1| putative deoxyribonuclease YjjV [Escherichia coli SE11] gi|209915103|dbj|BAG80177.1| conserved hypothetical protein [Escherichia coli SE11] Length = 260 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|188492291|ref|ZP_02999561.1| hydrolase, TatD family [Escherichia coli 53638] gi|188487490|gb|EDU62593.1| hydrolase, TatD family [Escherichia coli 53638] Length = 260 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|191167433|ref|ZP_03029248.1| hydrolase, TatD family [Escherichia coli B7A] gi|190902573|gb|EDV62307.1| hydrolase, TatD family [Escherichia coli B7A] Length = 260 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|193065641|ref|ZP_03046707.1| hydrolase, TatD family [Escherichia coli E22] gi|194429169|ref|ZP_03061698.1| hydrolase, TatD family [Escherichia coli B171] gi|260847269|ref|YP_003225047.1| putative DNase [Escherichia coli O103:H2 str. 12009] gi|192926714|gb|EDV81342.1| hydrolase, TatD family [Escherichia coli E22] gi|194412784|gb|EDX29077.1| hydrolase, TatD family [Escherichia coli B171] gi|257762416|dbj|BAI33913.1| predicted DNase [Escherichia coli O103:H2 str. 12009] gi|323163265|gb|EFZ49096.1| hypothetical protein ECE128010_0558 [Escherichia coli E128010] Length = 260 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|157155194|ref|YP_001465899.1| putative deoxyribonuclease YjjV [Escherichia coli E24377A] gi|256020009|ref|ZP_05433874.1| putative deoxyribonuclease YjjV [Shigella sp. D9] gi|260871102|ref|YP_003237504.1| putative DNase [Escherichia coli O111:H- str. 11128] gi|300824415|ref|ZP_07104528.1| hydrolase, TatD family [Escherichia coli MS 119-7] gi|309795653|ref|ZP_07690069.1| hydrolase, TatD family [Escherichia coli MS 145-7] gi|331680541|ref|ZP_08381200.1| putative deoxyribonuclease YjjV [Escherichia coli H591] gi|157077224|gb|ABV16932.1| hydrolase, TatD family [Escherichia coli E24377A] gi|257767458|dbj|BAI38953.1| predicted DNase [Escherichia coli O111:H- str. 11128] gi|300523057|gb|EFK44126.1| hydrolase, TatD family [Escherichia coli MS 119-7] gi|308120777|gb|EFO58039.1| hydrolase, TatD family [Escherichia coli MS 145-7] gi|323176282|gb|EFZ61874.1| hypothetical protein ECOK1180_4976 [Escherichia coli 1180] gi|324019803|gb|EGB89022.1| hydrolase, TatD family [Escherichia coli MS 117-3] gi|331072004|gb|EGI43340.1| putative deoxyribonuclease YjjV [Escherichia coli H591] gi|332103507|gb|EGJ06853.1| hydrolase [Shigella sp. D9] Length = 260 Score = 37.0 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|293417851|ref|ZP_06660473.1| Mg-dependent DNase [Escherichia coli B185] gi|291430569|gb|EFF03567.1| Mg-dependent DNase [Escherichia coli B185] Length = 260 Score = 37.0 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|91776266|ref|YP_546022.1| TatD-related deoxyribonuclease [Methylobacillus flagellatus KT] gi|91710253|gb|ABE50181.1| TatD-related deoxyribonuclease [Methylobacillus flagellatus KT] Length = 268 Score = 37.0 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 22/37 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+THCH P+FD DR V A QA V ++ A+ Sbjct: 4 LIDTHCHLDAPEFDHDRDEVAQAAWQAGVGIIVVPAV 40 >gi|74314813|ref|YP_313232.1| putative deoxyribonuclease YjjV [Shigella sonnei Ss046] gi|73858290|gb|AAZ90997.1| Mg-dependent DNase [Shigella sonnei Ss046] gi|323166186|gb|EFZ51964.1| hypothetical protein SS53G_3549 [Shigella sonnei 53G] Length = 260 Score = 37.0 bits (84), Expect = 0.94, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|189461914|ref|ZP_03010699.1| hypothetical protein BACCOP_02580 [Bacteroides coprocola DSM 17136] gi|189431308|gb|EDV00293.1| hypothetical protein BACCOP_02580 [Bacteroides coprocola DSM 17136] Length = 262 Score = 37.0 bits (84), Expect = 0.94, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 21/32 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 LI+TH H +FDEDR I+RA +A V ++ Sbjct: 4 LIDTHTHLFAEEFDEDRELAIIRATEAGVTRL 35 >gi|159897492|ref|YP_001543739.1| TatD family hydrolase [Herpetosiphon aurantiacus ATCC 23779] gi|159890531|gb|ABX03611.1| hydrolase, TatD family [Herpetosiphon aurantiacus ATCC 23779] Length = 256 Score = 37.0 bits (84), Expect = 0.95, Method: Composition-based stats. Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H FD+DR V RA A+V +MI I Sbjct: 1 MLIDTHTHVHSDQFDDDRAAVFERAQAADVTRMINIG 37 >gi|218698215|ref|YP_002405882.1| putative deoxyribonuclease YjjV [Escherichia coli 55989] gi|218354947|emb|CAV02175.1| putative DNase [Escherichia coli 55989] Length = 260 Score = 37.0 bits (84), Expect = 0.96, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|325495910|gb|EGC93769.1| deoxyribonuclease YjjV [Escherichia fergusonii ECD227] Length = 260 Score = 37.0 bits (84), Expect = 0.97, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 6 IDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|218551680|ref|YP_002385472.1| deoxyribonuclease YjjV [Escherichia fergusonii ATCC 35469] gi|218359222|emb|CAQ91888.1| putative DNase [Escherichia fergusonii ATCC 35469] Length = 260 Score = 37.0 bits (84), Expect = 0.97, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 6 IDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|300939363|ref|ZP_07154031.1| hydrolase, TatD family [Escherichia coli MS 21-1] gi|300455767|gb|EFK19260.1| hydrolase, TatD family [Escherichia coli MS 21-1] Length = 259 Score = 37.0 bits (84), Expect = 0.97, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|218708056|ref|YP_002415575.1| putative deoxyribonuclease YjjV [Escherichia coli UMN026] gi|293403047|ref|ZP_06647144.1| deoxyribonuclease YjjV [Escherichia coli FVEC1412] gi|298378574|ref|ZP_06988458.1| deoxyribonuclease YjjV [Escherichia coli FVEC1302] gi|300899337|ref|ZP_07117601.1| hydrolase, TatD family [Escherichia coli MS 198-1] gi|331661330|ref|ZP_08362254.1| putative deoxyribonuclease YjjV [Escherichia coli TA143] gi|218435153|emb|CAR16111.1| putative DNase [Escherichia coli UMN026] gi|291429962|gb|EFF02976.1| deoxyribonuclease YjjV [Escherichia coli FVEC1412] gi|298280908|gb|EFI22409.1| deoxyribonuclease YjjV [Escherichia coli FVEC1302] gi|300357061|gb|EFJ72931.1| hydrolase, TatD family [Escherichia coli MS 198-1] gi|331061245|gb|EGI33208.1| putative deoxyribonuclease YjjV [Escherichia coli TA143] Length = 259 Score = 37.0 bits (84), Expect = 0.98, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|319783482|ref|YP_004142958.1| hydrolase, TatD family [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169370|gb|ADV12908.1| hydrolase, TatD family [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 264 Score = 36.6 bits (83), Expect = 1.0, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF E+R ++ RA A + +M+ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAEERAAIVARASAAGIGRMVTISTRVKR 42 >gi|293408062|ref|ZP_06651902.1| deoxyribonuclease YjjV [Escherichia coli B354] gi|291472313|gb|EFF14795.1| deoxyribonuclease YjjV [Escherichia coli B354] Length = 259 Score = 36.6 bits (83), Expect = 1.0, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|13470649|ref|NP_102218.1| hypothetical protein mll0418 [Mesorhizobium loti MAFF303099] gi|14021391|dbj|BAB48004.1| mll0418 [Mesorhizobium loti MAFF303099] Length = 264 Score = 36.6 bits (83), Expect = 1.0, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF E+R ++ RA A + +M+ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAEERAAIVARAKAAGIGRMVTISTRVKR 42 >gi|301330273|ref|ZP_07222927.1| hydrolase, TatD family [Escherichia coli MS 78-1] gi|301646895|ref|ZP_07246741.1| hydrolase, TatD family [Escherichia coli MS 146-1] gi|307136577|ref|ZP_07495933.1| putative deoxyribonuclease YjjV [Escherichia coli H736] gi|312966092|ref|ZP_07780318.1| uncharacterized deoxyribonuclease yjjV [Escherichia coli 2362-75] gi|331640420|ref|ZP_08341568.1| putative deoxyribonuclease YjjV [Escherichia coli H736] gi|300843732|gb|EFK71492.1| hydrolase, TatD family [Escherichia coli MS 78-1] gi|301074948|gb|EFK89754.1| hydrolase, TatD family [Escherichia coli MS 146-1] gi|312289335|gb|EFR17229.1| uncharacterized deoxyribonuclease yjjV [Escherichia coli 2362-75] gi|331040166|gb|EGI12373.1| putative deoxyribonuclease YjjV [Escherichia coli H736] Length = 260 Score = 36.6 bits (83), Expect = 1.0, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|161504888|ref|YP_001572000.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|160866235|gb|ABX22858.1| hypothetical protein SARI_03014 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] Length = 257 Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 21/39 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDELASIQRAREAGVEKIIVPATEA 43 >gi|331681362|ref|ZP_08381999.1| putative deoxyribonuclease YjjV [Escherichia coli H299] gi|331081583|gb|EGI52744.1| putative deoxyribonuclease YjjV [Escherichia coli H299] Length = 259 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|170680245|ref|YP_001746833.1| putative deoxyribonuclease YjjV [Escherichia coli SMS-3-5] gi|170517963|gb|ACB16141.1| hydrolase, TatD family [Escherichia coli SMS-3-5] Length = 260 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|110644815|ref|YP_672545.1| putative deoxyribonuclease YjjV [Escherichia coli 536] gi|191173142|ref|ZP_03034674.1| hydrolase, TatD family [Escherichia coli F11] gi|300983958|ref|ZP_07176809.1| hydrolase, TatD family [Escherichia coli MS 200-1] gi|306815426|ref|ZP_07449575.1| putative deoxyribonuclease YjjV [Escherichia coli NC101] gi|110346407|gb|ABG72644.1| putative deoxyribonuclease YjjV [Escherichia coli 536] gi|190906527|gb|EDV66134.1| hydrolase, TatD family [Escherichia coli F11] gi|300306792|gb|EFJ61312.1| hydrolase, TatD family [Escherichia coli MS 200-1] gi|305851088|gb|EFM51543.1| putative deoxyribonuclease YjjV [Escherichia coli NC101] gi|324012384|gb|EGB81603.1| hydrolase, TatD family [Escherichia coli MS 60-1] Length = 259 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|16126065|ref|NP_420629.1| urease/pyrimidinase family protein [Caulobacter crescentus CB15] gi|221234835|ref|YP_002517271.1| DNase, TatD family [Caulobacter crescentus NA1000] gi|13423257|gb|AAK23797.1| urease/pyrimidinase family protein [Caulobacter crescentus CB15] gi|220964007|gb|ACL95363.1| DNase, TatD family [Caulobacter crescentus NA1000] Length = 262 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P F ED+ VI RA +A + M+ I KV Sbjct: 4 MLIDSHVNLHAPQFAEDKDAVIARAREAGIAMMVTICDKV 43 >gi|198421633|ref|XP_002123991.1| PREDICTED: similar to TatD DNase domain containing 3 [Ciona intestinalis] Length = 272 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 I+ HCH +F+ DRH VI RA ANV +I + Sbjct: 9 IDCHCHLSCTEFNVDRHKVIERAKAANVQAIIIV 42 >gi|26251267|ref|NP_757307.1| putative deoxyribonuclease YjjV [Escherichia coli CFT073] gi|91214093|ref|YP_544079.1| putative deoxyribonuclease YjjV [Escherichia coli UTI89] gi|218692766|ref|YP_002400978.1| putative deoxyribonuclease YjjV [Escherichia coli ED1a] gi|218703125|ref|YP_002410754.1| putative deoxyribonuclease YjjV [Escherichia coli IAI39] gi|227885135|ref|ZP_04002940.1| deoxyribonuclease YjjV [Escherichia coli 83972] gi|300980816|ref|ZP_07175197.1| hydrolase, TatD family [Escherichia coli MS 45-1] gi|301048342|ref|ZP_07195372.1| hydrolase, TatD family [Escherichia coli MS 185-1] gi|331661009|ref|ZP_08361941.1| putative deoxyribonuclease YjjV [Escherichia coli TA206] gi|26111700|gb|AAN83881.1|AE016772_59 Putative deoxyribonuclease yjjV [Escherichia coli CFT073] gi|91075667|gb|ABE10548.1| putative deoxyribonuclease YjjV [Escherichia coli UTI89] gi|218373111|emb|CAR21003.1| putative DNase [Escherichia coli IAI39] gi|218430330|emb|CAR11200.1| putative DNase [Escherichia coli ED1a] gi|222036120|emb|CAP78865.1| Uncharacterized deoxyribonuclease yjjV [Escherichia coli LF82] gi|227837964|gb|EEJ48430.1| deoxyribonuclease YjjV [Escherichia coli 83972] gi|294493243|gb|ADE91999.1| hydrolase, TatD family [Escherichia coli IHE3034] gi|300299802|gb|EFJ56187.1| hydrolase, TatD family [Escherichia coli MS 185-1] gi|300409133|gb|EFJ92671.1| hydrolase, TatD family [Escherichia coli MS 45-1] gi|307556611|gb|ADN49386.1| putative deoxyribonuclease YjjV [Escherichia coli ABU 83972] gi|307629547|gb|ADN73851.1| putative deoxyribonuclease YjjV [Escherichia coli UM146] gi|312949007|gb|ADR29834.1| putative deoxyribonuclease YjjV [Escherichia coli O83:H1 str. NRG 857C] gi|315293332|gb|EFU52684.1| hydrolase, TatD family [Escherichia coli MS 153-1] gi|315298357|gb|EFU57612.1| hydrolase, TatD family [Escherichia coli MS 16-3] gi|323950536|gb|EGB46414.1| TatD family protein hydrolase [Escherichia coli H252] gi|331052051|gb|EGI24090.1| putative deoxyribonuclease YjjV [Escherichia coli TA206] Length = 259 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|89111086|ref|AP_004866.1| predicted DNase [Escherichia coli str. K-12 substr. W3110] gi|90111745|ref|YP_026291.2| predicted DNase [Escherichia coli str. K-12 substr. MG1655] gi|170083764|ref|YP_001733084.1| DNase [Escherichia coli str. K-12 substr. DH10B] gi|218561609|ref|YP_002394522.1| deoxyribonuclease YjjV [Escherichia coli S88] gi|238903465|ref|YP_002929261.1| putative DNase [Escherichia coli BW2952] gi|253774992|ref|YP_003037823.1| deoxyribonuclease YjjV [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254164304|ref|YP_003047414.1| putative deoxyribonuclease YjjV [Escherichia coli B str. REL606] gi|297518543|ref|ZP_06936929.1| putative deoxyribonuclease YjjV [Escherichia coli OP50] gi|312970068|ref|ZP_07784250.1| uncharacterized deoxyribonuclease yjjV [Escherichia coli 1827-70] gi|1176481|sp|P39408|YJJV_ECOLI RecName: Full=Uncharacterized deoxyribonuclease yjjV gi|71042572|pdb|1ZZM|A Chain A, Crystal Structure Of Yjjv, Tatd Homolog From Escherichia Coli K12, At 1.8 A Resolution gi|85677117|dbj|BAE78367.1| predicted DNase [Escherichia coli str. K12 substr. W3110] gi|87082439|gb|AAC77331.2| predicted DNase [Escherichia coli str. K-12 substr. MG1655] gi|169891599|gb|ACB05306.1| predicted DNase [Escherichia coli str. K-12 substr. DH10B] gi|218368378|emb|CAR06198.1| putative DNase [Escherichia coli S88] gi|238862336|gb|ACR64334.1| predicted DNase [Escherichia coli BW2952] gi|242379900|emb|CAQ34737.1| predicted DNase [Escherichia coli BL21(DE3)] gi|253326036|gb|ACT30638.1| TatD-related deoxyribonuclease [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253976207|gb|ACT41878.1| predicted DNase [Escherichia coli B str. REL606] gi|253980364|gb|ACT46034.1| predicted DNase [Escherichia coli BL21(DE3)] gi|260450811|gb|ACX41233.1| TatD-related deoxyribonuclease [Escherichia coli DH1] gi|310337566|gb|EFQ02677.1| uncharacterized deoxyribonuclease yjjV [Escherichia coli 1827-70] gi|315138931|dbj|BAJ46090.1| putative deoxyribonuclease YjjV [Escherichia coli DH1] Length = 259 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|188532812|ref|YP_001906609.1| Mg-dependent DNase [Erwinia tasmaniensis Et1/99] gi|188027854|emb|CAO95711.1| Mg-dependent DNase [Erwinia tasmaniensis Et1/99] Length = 258 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++THCHF P F D + RA A V K+IA+ + R Sbjct: 5 FVDTHCHFDFPPFVGDEEASLARAAHAGVEKIIAVGVSAPR 45 >gi|255264411|ref|ZP_05343753.1| hydrolase, TatD family [Thalassiobium sp. R2A62] gi|255106746|gb|EET49420.1| hydrolase, TatD family [Thalassiobium sp. R2A62] Length = 267 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++++HCH DFD + +I RA +A V +M+ I ++ Sbjct: 6 IVDSHCHLDFEDFDGEHSELIARAAEAGVTRMVTICTRL 44 >gi|324007709|gb|EGB76928.1| hydrolase, TatD family [Escherichia coli MS 57-2] Length = 259 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|331645075|ref|ZP_08346186.1| putative deoxyribonuclease YjjV [Escherichia coli M605] gi|330909823|gb|EGH38333.1| putative deoxyribonuclease YjjV [Escherichia coli AA86] gi|331045832|gb|EGI17951.1| putative deoxyribonuclease YjjV [Escherichia coli M605] Length = 259 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|270308205|ref|YP_003330263.1| hydrolase, TatD family, Mg-dependent DNase [Dehalococcoides sp. VS] gi|270154097|gb|ACZ61935.1| hydrolase, TatD family, Mg-dependent DNase [Dehalococcoides sp. VS] Length = 264 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 23/41 (56%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 I+TH H +P+FD DR + RA + V +I I ++ + Sbjct: 7 IDTHAHLDMPEFDTDRQEIFRRAFENGVKTIITTGIDILSS 47 >gi|90022697|ref|YP_528524.1| putative deoxyribonuclease [Saccharophagus degradans 2-40] gi|89952297|gb|ABD82312.1| TatD-related deoxyribonuclease [Saccharophagus degradans 2-40] Length = 263 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCH P FD DR V+ + +A V K++ Sbjct: 6 MIDTHCHIDFPKFDADRQAVLASSLRAGVQKIV 38 >gi|224025694|ref|ZP_03644060.1| hypothetical protein BACCOPRO_02435 [Bacteroides coprophilus DSM 18228] gi|224018930|gb|EEF76928.1| hypothetical protein BACCOPRO_02435 [Bacteroides coprophilus DSM 18228] Length = 262 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 21/32 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 LI+TH H +FDEDR ++RA +A V ++ Sbjct: 4 LIDTHTHLFAEEFDEDRELAVLRAGEAGVTRL 35 >gi|215489690|ref|YP_002332121.1| putative deoxyribonuclease YjjV [Escherichia coli O127:H6 str. E2348/69] gi|215267762|emb|CAS12224.1| predicted DNase [Escherichia coli O127:H6 str. E2348/69] Length = 259 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|323190346|gb|EFZ75622.1| hypothetical protein ECRN5871_1501 [Escherichia coli RN587/1] Length = 260 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|324112631|gb|EGC06608.1| TatD family protein hydrolase [Escherichia fergusonii B253] Length = 260 Score = 36.2 bits (82), Expect = 1.3, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEANLQRAAQAGVGKIIVPATE 42 >gi|255022089|ref|ZP_05294093.1| Putative deoxyribonuclease YcfH [Acidithiobacillus caldus ATCC 51756] gi|254968447|gb|EET26005.1| Putative deoxyribonuclease YcfH [Acidithiobacillus caldus ATCC 51756] Length = 261 Score = 36.2 bits (82), Expect = 1.3, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 22/37 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L+++HCH DF EDR V+ RA A V ++ A+ Sbjct: 5 LVDSHCHLDFDDFAEDRDAVLARARAAGVEHLLIAAV 41 >gi|308188083|ref|YP_003932214.1| deoxyribonuclease [Pantoea vagans C9-1] gi|308058593|gb|ADO10765.1| putative deoxyribonuclease [Pantoea vagans C9-1] Length = 265 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 23/41 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F+ D + RA +A V K+I AI R Sbjct: 3 FIDTHCHFDFPPFEGDVAASLTRAAEAGVEKIIIPAIDASR 43 >gi|110596795|ref|ZP_01385085.1| TatD-related deoxyribonuclease [Chlorobium ferrooxidans DSM 13031] gi|110341482|gb|EAT59942.1| TatD-related deoxyribonuclease [Chlorobium ferrooxidans DSM 13031] Length = 257 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 22/40 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML++TH H PDFD DR +I R + V +I I V Sbjct: 1 MLVDTHAHLSFPDFDNDRKEIIERLCREGVRLLIDPGIDV 40 >gi|119356541|ref|YP_911185.1| TatD family hydrolase [Chlorobium phaeobacteroides DSM 266] gi|119353890|gb|ABL64761.1| hydrolase, TatD family [Chlorobium phaeobacteroides DSM 266] Length = 255 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+ HCH P+FD+DR VI R + + +I Sbjct: 1 MFIDAHCHLSFPEFDQDRSEVIERLNAGGISLLI 34 >gi|77919293|ref|YP_357108.1| Mg-dependent DNase [Pelobacter carbinolicus DSM 2380] gi|77545376|gb|ABA88938.1| Mg-dependent DNase [Pelobacter carbinolicus DSM 2380] Length = 464 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI+TH H +D+DR +VI RA Q+ + MI I Sbjct: 8 LIDTHAHLDSRQYDQDRQDVIQRALQSGITHMITIG 43 >gi|90581534|ref|ZP_01237327.1| hypothetical protein VAS14_07259 [Vibrio angustum S14] gi|90437296|gb|EAS62494.1| hypothetical protein VAS14_07259 [Vibrio angustum S14] Length = 260 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCHF P F++D +M A + V K++ Sbjct: 1 MIDTHCHFDFPPFNDDPKRALMLAQEGGVKKIV 33 >gi|145219352|ref|YP_001130061.1| TatD family hydrolase [Prosthecochloris vibrioformis DSM 265] gi|145205516|gb|ABP36559.1| hydrolase, TatD family [Chlorobium phaeovibrioides DSM 265] Length = 257 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M + HCH P FDEDR VI R +A V +I Sbjct: 1 MFADAHCHLSFPAFDEDRPAVIERMKEAGVTLLI 34 >gi|330501811|ref|YP_004378680.1| TatD family hydrolase [Pseudomonas mendocina NK-01] gi|328916097|gb|AEB56928.1| TatD family hydrolase [Pseudomonas mendocina NK-01] Length = 259 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +TH H PDFD DR V+ R+ V +M+ + + Sbjct: 3 LTDTHTHLDFPDFDADRDEVLARSRALGVQRMVVLGV 39 >gi|94264605|ref|ZP_01288389.1| TatD-related deoxyribonuclease [delta proteobacterium MLMS-1] gi|93454959|gb|EAT05196.1| TatD-related deoxyribonuclease [delta proteobacterium MLMS-1] Length = 275 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 LI+THCH PD+ D ++ RA Q V ++ + I + Sbjct: 18 LIDTHCHLDFPDYAADYDQLLERARQVGVEAVVTVGIDL 56 >gi|94269741|ref|ZP_01291547.1| TatD-related deoxyribonuclease [delta proteobacterium MLMS-1] gi|93451097|gb|EAT02038.1| TatD-related deoxyribonuclease [delta proteobacterium MLMS-1] Length = 275 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 LI+THCH PD+ D ++ RA Q V ++ + I + Sbjct: 18 LIDTHCHLDFPDYAADYDQLLERARQVGVEAVVTVGIDL 56 >gi|320195329|gb|EFW69957.1| Putative deoxyribonuclease YjjV [Escherichia coli WV_060327] Length = 259 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F D + RA QA V K+I Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKII 37 >gi|283788415|ref|YP_003368280.1| putative deoxyribonuclease [Citrobacter rodentium ICC168] gi|282951869|emb|CBG91585.1| putative deoxyribonuclease [Citrobacter rodentium ICC168] Length = 258 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K++ A + Sbjct: 5 FIDTHCHFDFPPFTGDEQACLQRAAQAGVEKIVVPATE 42 >gi|294496592|ref|YP_003543085.1| hydrolase, TatD family [Methanohalophilus mahii DSM 5219] gi|292667591|gb|ADE37440.1| hydrolase, TatD family [Methanohalophilus mahii DSM 5219] Length = 272 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 I++HCH F++DR VI+RA +A +MI I + Sbjct: 25 FIDSHCHLDFSKFNKDREEVILRAKEAGACEMINSGIDL 63 >gi|163849127|ref|YP_001637171.1| TatD family hydrolase [Chloroflexus aurantiacus J-10-fl] gi|222527099|ref|YP_002571570.1| hydrolase, TatD family [Chloroflexus sp. Y-400-fl] gi|163670416|gb|ABY36782.1| hydrolase, TatD family [Chloroflexus aurantiacus J-10-fl] gi|222450978|gb|ACM55244.1| hydrolase, TatD family [Chloroflexus sp. Y-400-fl] Length = 263 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 21/36 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI+TH H F+EDR VI+RA A V MI I Sbjct: 7 LIDTHLHLASEQFNEDRSAVILRAIDAGVAAMIEIG 42 >gi|217970672|ref|YP_002355906.1| TatD-related deoxyribonuclease [Thauera sp. MZ1T] gi|217507999|gb|ACK55010.1| TatD-related deoxyribonuclease [Thauera sp. MZ1T] Length = 263 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 +LI+TH H +FD+DR VI RA A V + + A++ Sbjct: 6 VLIDTHVHLDAAEFDDDREQVIARARAAGVGRFVVPAVE 44 >gi|258591915|emb|CBE68220.1| Putative deoxyribonuclease (ycfH) [NC10 bacterium 'Dutch sediment'] Length = 264 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H + +FD DR + RA A + M+A+ Sbjct: 1 MLIDTHAHIQMQEFDHDRAEALTRAEAAGIGLMLAVG 37 >gi|152973299|ref|YP_001338445.1| putative hydrolase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|150958148|gb|ABR80178.1| putative hydrolase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 264 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F D + RA QA V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAADEVASLARAAQAGVERIIVPAISAER 45 >gi|262044976|ref|ZP_06018018.1| TatD family deoxyribonuclease [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|259037703|gb|EEW38932.1| TatD family deoxyribonuclease [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length = 264 Score = 35.8 bits (81), Expect = 1.7, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F D + RA QA V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAADEVASLARAAQAGVGRIIVPAISAER 45 >gi|197294724|ref|YP_001799265.1| Mg-dependent DNase [Candidatus Phytoplasma australiense] gi|171854051|emb|CAM12024.1| Mg-dependent DNase [Candidatus Phytoplasma australiense] Length = 255 Score = 35.8 bits (81), Expect = 1.7, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 25/38 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 MLI+TH H + ++D+D V+ RA Q +V KMI + + Sbjct: 1 MLIDTHAHLNVANYDKDLDEVLKRAFQNDVKKMIVVGM 38 >gi|325269798|ref|ZP_08136408.1| TatD family deoxyribonuclease [Prevotella multiformis DSM 16608] gi|324987771|gb|EGC19744.1| TatD family deoxyribonuclease [Prevotella multiformis DSM 16608] Length = 271 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M+I+TH H + DF D V+ RAH+A V K+ AI + Sbjct: 1 MIIDTHAHLDVEDFKTDLPEVVRRAHEAGVGKIFLPAIDL 40 >gi|149914151|ref|ZP_01902682.1| 3-hydroxydecanoyl-ACP dehydratase [Roseobacter sp. AzwK-3b] gi|149811670|gb|EDM71503.1| 3-hydroxydecanoyl-ACP dehydratase [Roseobacter sp. AzwK-3b] Length = 268 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 22/39 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH FD DR V+ RA A V +M+ I K+ Sbjct: 7 ITDSHCHLDFDVFDADRDQVVQRAVDAGVARMVTICTKL 45 >gi|84683871|ref|ZP_01011774.1| hydrolase, TatD family protein [Maritimibacter alkaliphilus HTCC2654] gi|84668614|gb|EAQ15081.1| hydrolase, TatD family protein [Rhodobacterales bacterium HTCC2654] Length = 262 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF+ +I A +A V +M+ IA K+ Sbjct: 7 ITDSHCHLDFPDFEGQLDEIISHAAEAGVTRMVTIATKL 45 >gi|312144345|ref|YP_003995791.1| hydrolase, TatD family [Halanaerobium sp. 'sapolanicus'] gi|311904996|gb|ADQ15437.1| hydrolase, TatD family [Halanaerobium sp. 'sapolanicus'] Length = 255 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI+TH H D+D+DR V RA +A V ++I I Sbjct: 3 LIDTHAHLDFNDYDKDREEVFSRAREAGVEEIINIG 38 >gi|169797213|ref|YP_001715006.1| hypothetical protein ABAYE3229 [Acinetobacter baumannii AYE] gi|213155994|ref|YP_002318039.1| hydrolase, TatD family [Acinetobacter baumannii AB0057] gi|215484654|ref|YP_002326889.1| Putative deoxyribonuclease yjjV [Acinetobacter baumannii AB307-0294] gi|294836300|ref|ZP_06780983.1| Putative deoxyribonuclease yjjV [Acinetobacter sp. 6013113] gi|294857760|ref|ZP_06795529.1| Putative deoxyribonuclease yjjV [Acinetobacter sp. 6013150] gi|301346808|ref|ZP_07227549.1| Putative deoxyribonuclease yjjV [Acinetobacter baumannii AB056] gi|301510093|ref|ZP_07235330.1| Putative deoxyribonuclease yjjV [Acinetobacter baumannii AB058] gi|301594651|ref|ZP_07239659.1| Putative deoxyribonuclease yjjV [Acinetobacter baumannii AB059] gi|169150140|emb|CAM88034.1| conserved hypothetical protein [Acinetobacter baumannii AYE] gi|213055154|gb|ACJ40056.1| hydrolase, TatD family [Acinetobacter baumannii AB0057] gi|213988370|gb|ACJ58669.1| Putative deoxyribonuclease yjjV [Acinetobacter baumannii AB307-0294] Length = 270 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L +TH HF + DFDEDRH + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRHQLALEAKKVGVNALVLIG 38 >gi|56551989|ref|YP_162828.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis ZM4] gi|241761928|ref|ZP_04760013.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|56543563|gb|AAV89717.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis ZM4] gi|241373608|gb|EER63180.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 258 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI++HCH P E + ++ RA Q+ V M+ +A K Sbjct: 1 MLIDSHCHLNYPGMLEKQPEILQRARQSGVTGMVNVATK 39 >gi|325300425|ref|YP_004260342.1| hydrolase, TatD family [Bacteroides salanitronis DSM 18170] gi|324319978|gb|ADY37869.1| hydrolase, TatD family [Bacteroides salanitronis DSM 18170] Length = 263 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 21/31 (67%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 L++TH H + ++DEDR ++RA QA V + Sbjct: 4 LVDTHTHLFVEEYDEDRELALIRARQAGVTR 34 >gi|194366418|ref|YP_002029028.1| hydrolase, TatD family [Stenotrophomonas maltophilia R551-3] gi|194349222|gb|ACF52345.1| hydrolase, TatD family [Stenotrophomonas maltophilia R551-3] Length = 256 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 23/38 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 +L+++HCH +FD DR V+ RA A V + + A+ Sbjct: 3 LLVDSHCHLDASEFDRDRAAVVERAQAAGVHQQVVPAV 40 >gi|330006942|ref|ZP_08305811.1| hydrolase, TatD family [Klebsiella sp. MS 92-3] gi|328535629|gb|EGF62081.1| hydrolase, TatD family [Klebsiella sp. MS 92-3] Length = 264 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F D + RA QA V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAADEVASLARAAQAGVGRIIVPAISAER 45 >gi|319408566|emb|CBI82219.1| putative deoxyribonuclease [Bartonella schoenbuchensis R1] Length = 256 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I+THCH DF +D VI RA +V +MI I+ V Sbjct: 1 MIDTHCHLDFEDFAQDLDGVIQRALAVDVGRMITISTHV 39 >gi|224436938|ref|ZP_03657919.1| hypothetical protein HcinC1_03150 [Helicobacter cinaedi CCUG 18818] gi|313143410|ref|ZP_07805603.1| hydrolase [Helicobacter cinaedi CCUG 18818] gi|313128441|gb|EFR46058.1| hydrolase [Helicobacter cinaedi CCUG 18818] Length = 263 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCH FDED +VI RA NV K+I Sbjct: 1 MIDTHCHLDSTRFDEDLDSVIQRAFSHNVKKII 33 >gi|260752468|ref|YP_003225361.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|258551831|gb|ACV74777.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 258 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI++HCH P E + ++ RA Q+ V M+ +A K Sbjct: 1 MLIDSHCHLNYPGMLEKQPEILQRARQSGVTGMVNVATK 39 >gi|184156881|ref|YP_001845220.1| Mg-dependent DNase [Acinetobacter baumannii ACICU] gi|294840244|ref|ZP_06784927.1| Mg-dependent DNase [Acinetobacter sp. 6014059] gi|183208475|gb|ACC55873.1| Mg-dependent DNase [Acinetobacter baumannii ACICU] gi|322506776|gb|ADX02230.1| Mg-dependent DNase [Acinetobacter baumannii 1656-2] gi|323516646|gb|ADX91027.1| Mg-dependent DNase [Acinetobacter baumannii TCDC-AB0715] Length = 270 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L +TH HF + DFDEDRH + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRHQLALEAKKVGVDALVLIG 38 >gi|291225995|ref|XP_002732970.1| PREDICTED: Cell-death-Related Nuclease family member (crn-2)-like [Saccoglossus kowalevskii] Length = 273 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I+ HCH +FDED +VI RA + V ++A+A Sbjct: 7 IDCHCHIAAEEFDEDIDDVIKRAKENKVAGIVAVA 41 >gi|258513471|ref|YP_003189693.1| hydrolase, TatD family [Desulfotomaculum acetoxidans DSM 771] gi|257777176|gb|ACV61070.1| hydrolase, TatD family [Desulfotomaculum acetoxidans DSM 771] Length = 256 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 18/37 (48%), Positives = 23/37 (62%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H F++DR VI RA A V+K+I A Sbjct: 1 MLIDTHAHLDHQKFEQDRDEVIARAGTAGVVKIINAA 37 >gi|307292796|ref|ZP_07572642.1| hydrolase, TatD family [Sphingobium chlorophenolicum L-1] gi|306880862|gb|EFN12078.1| hydrolase, TatD family [Sphingobium chlorophenolicum L-1] Length = 257 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI++HCH ED+ NV+ RA A V M+ IA + Sbjct: 1 MLIDSHCHLNYKGLIEDQKNVLERARSAGVGLMLNIATR 39 >gi|160900830|ref|YP_001566412.1| TatD-like deoxyribonuclease [Delftia acidovorans SPH-1] gi|160366414|gb|ABX38027.1| TatD-related deoxyribonuclease [Delftia acidovorans SPH-1] Length = 293 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 I+THCH P+FD DR V +A +A V ++ A+ Sbjct: 25 IDTHCHLDAPEFDADRDAVRAQAAEAGVAHLVIPAV 60 >gi|262404843|ref|ZP_06081397.1| deoxyribonuclease TatD [Vibrio sp. RC586] gi|262348927|gb|EEY98066.1| deoxyribonuclease TatD [Vibrio sp. RC586] Length = 255 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA QA + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQAGIEKIL 33 >gi|285017926|ref|YP_003375637.1| hypothetical protein XALc_1135 [Xanthomonas albilineans GPE PC73] gi|283473144|emb|CBA15650.1| conserved hypothetical protein [Xanthomonas albilineans] Length = 261 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH FD DR VI RA A V+ I A+ Sbjct: 3 LIDSHCHLDADAFDHDRAAVIARAQNAGVVAQIVPAV 39 >gi|262380222|ref|ZP_06073377.1| conserved hypothetical protein [Acinetobacter radioresistens SH164] gi|262298416|gb|EEY86330.1| conserved hypothetical protein [Acinetobacter radioresistens SH164] Length = 276 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L +TH HF +PDFD DR ++ A A V K++ I Sbjct: 3 LFDTHTHFDVPDFDADREHLAYEAKAAGVEKLVLIG 38 >gi|330831156|ref|YP_004394108.1| TatD family Mg-dependent DNase [Aeromonas veronii B565] gi|328806292|gb|AEB51491.1| Mg-dependent DNase, TatD-family [Aeromonas veronii B565] Length = 257 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+THCH P FD+DR ++ R V + I AI Sbjct: 3 LIDTHCHLDFPVFDQDREALLARCRALGVTEYIIPAI 39 >gi|255320924|ref|ZP_05362098.1| Mg-dependent DNase [Acinetobacter radioresistens SK82] gi|255302093|gb|EET81336.1| Mg-dependent DNase [Acinetobacter radioresistens SK82] Length = 279 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L +TH HF +PDFD DR ++ A A V K++ I Sbjct: 6 LFDTHTHFDVPDFDADREHLAYEAKAAGVEKLVLIG 41 >gi|238892966|ref|YP_002917700.1| putative hydrolase [Klebsiella pneumoniae NTUH-K2044] gi|238545282|dbj|BAH61633.1| putative hydrolase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] Length = 264 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F D + RA QA V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAADEVASLARAAQAGVGRIIVPAISAER 45 >gi|204927301|ref|ZP_03218503.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|204323966|gb|EDZ09161.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] Length = 257 Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRAGEAGVEKIIVPATE 42 >gi|197105066|ref|YP_002130443.1| urease/pyrimidinase family protein [Phenylobacterium zucineum HLK1] gi|196478486|gb|ACG78014.1| urease/pyrimidinase family protein [Phenylobacterium zucineum HLK1] Length = 258 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P FD+DR VI RA A V M+ I +V Sbjct: 1 MLIDSHVNLHAPQFDDDREAVISRALAAGVRLMVNICDRV 40 >gi|194434162|ref|ZP_03066430.1| hydrolase, TatD family [Shigella dysenteriae 1012] gi|194417599|gb|EDX33700.1| hydrolase, TatD family [Shigella dysenteriae 1012] gi|320177703|gb|EFW52692.1| Putative deoxyribonuclease YjjV [Shigella boydii ATCC 9905] gi|332083371|gb|EGI88602.1| hypothetical protein SB521682_5254 [Shigella boydii 5216-82] gi|332098347|gb|EGJ03320.1| hypothetical protein SD15574_0019 [Shigella dysenteriae 155-74] Length = 260 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATE 42 >gi|289551710|ref|YP_003472614.1| Putative deoxyribonuclease YcfH [Staphylococcus lugdunensis HKU09-01] gi|289181241|gb|ADC88486.1| Putative deoxyribonuclease YcfH [Staphylococcus lugdunensis HKU09-01] Length = 256 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H +DED VI RA QA V +M + Sbjct: 1 MLIDTHVHLNDEQYDEDLSEVISRAQQAGVDRMFVVG 37 >gi|168750985|ref|ZP_02776007.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4113] gi|168756796|ref|ZP_02781803.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4401] gi|168762729|ref|ZP_02787736.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4501] gi|168766659|ref|ZP_02791666.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4486] gi|168776644|ref|ZP_02801651.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4196] gi|168781667|ref|ZP_02806674.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4076] gi|168785021|ref|ZP_02810028.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC869] gi|168797950|ref|ZP_02822957.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC508] gi|195937650|ref|ZP_03083032.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. EC4024] gi|208807002|ref|ZP_03249339.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4206] gi|208812800|ref|ZP_03254129.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4045] gi|208821271|ref|ZP_03261591.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4042] gi|209397271|ref|YP_002273899.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4115] gi|217324568|ref|ZP_03440652.1| hydrolase, TatD family [Escherichia coli O157:H7 str. TW14588] gi|254796374|ref|YP_003081211.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. TW14359] gi|261226735|ref|ZP_05941016.1| predicted DNase [Escherichia coli O157:H7 str. FRIK2000] gi|261255139|ref|ZP_05947672.1| predicted DNase [Escherichia coli O157:H7 str. FRIK966] gi|187768037|gb|EDU31881.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4196] gi|188014919|gb|EDU53041.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4113] gi|189000760|gb|EDU69746.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4076] gi|189356069|gb|EDU74488.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4401] gi|189363936|gb|EDU82355.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4486] gi|189366970|gb|EDU85386.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4501] gi|189375036|gb|EDU93452.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC869] gi|189379565|gb|EDU97981.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC508] gi|208726803|gb|EDZ76404.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4206] gi|208734077|gb|EDZ82764.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4045] gi|208741394|gb|EDZ89076.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4042] gi|209158671|gb|ACI36104.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4115] gi|217320789|gb|EEC29213.1| hydrolase, TatD family [Escherichia coli O157:H7 str. TW14588] gi|254595774|gb|ACT75135.1| predicted DNase [Escherichia coli O157:H7 str. TW14359] gi|320190506|gb|EFW65156.1| Putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. EC1212] gi|320638598|gb|EFX08303.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. G5101] gi|326345309|gb|EGD69052.1| Putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. 1125] gi|326346837|gb|EGD70571.1| Putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. 1044] Length = 260 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATE 42 >gi|110808167|ref|YP_691687.1| putative deoxyribonuclease YjjV [Shigella flexneri 5 str. 8401] gi|110617715|gb|ABF06382.1| Mg-dependent DNase [Shigella flexneri 5 str. 8401] Length = 260 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATE 42 >gi|227357384|ref|ZP_03841740.1| TatD family deoxyribonuclease [Proteus mirabilis ATCC 29906] gi|227162464|gb|EEI47458.1| TatD family deoxyribonuclease [Proteus mirabilis ATCC 29906] Length = 260 Score = 35.4 bits (80), Expect = 2.2, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 I+THCHF P F D N + A QA V K+I A+ Sbjct: 4 FIDTHCHFDFPVFYHDLENSLALAQQAQVKKIIIPAV 40 >gi|193076353|gb|ABO11010.2| hypothetical protein A1S_0557 [Acinetobacter baumannii ATCC 17978] Length = 276 Score = 35.4 bits (80), Expect = 2.2, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L +TH HF + DFDEDRH + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRHQLALEAKKVGVDALVLIG 38 >gi|197286265|ref|YP_002152137.1| TatD-related deoxyribonuclease [Proteus mirabilis HI4320] gi|194683752|emb|CAR44782.1| putative TatD-related deoxyribonuclease [Proteus mirabilis HI4320] Length = 260 Score = 35.4 bits (80), Expect = 2.3, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 I+THCHF P F D N + A QA V K+I A+ Sbjct: 4 FIDTHCHFDFPVFYHDLENSLALAQQAQVKKIIIPAV 40 >gi|120598009|ref|YP_962583.1| TatD-related deoxyribonuclease [Shewanella sp. W3-18-1] gi|120558102|gb|ABM24029.1| TatD-related deoxyribonuclease [Shewanella sp. W3-18-1] Length = 254 Score = 35.4 bits (80), Expect = 2.3, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++TH H +FD DR +V+++ HQA + +I Sbjct: 1 MLDTHAHLDFAEFDADRSDVVLKMHQAGIKNLI 33 >gi|315660342|ref|ZP_07913195.1| TatD family deoxyribonuclease [Staphylococcus lugdunensis M23590] gi|315494631|gb|EFU82973.1| TatD family deoxyribonuclease [Staphylococcus lugdunensis M23590] Length = 257 Score = 35.4 bits (80), Expect = 2.3, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H +DED VI RA QA V +M + Sbjct: 2 MLIDTHVHLNDEQYDEDLSEVISRAQQAGVDRMFVVG 38 >gi|281603715|gb|ADA76699.1| Mg-dependent DNase [Shigella flexneri 2002017] gi|313646266|gb|EFS10728.1| uncharacterized deoxyribonuclease yjjV [Shigella flexneri 2a str. 2457T] Length = 260 Score = 35.4 bits (80), Expect = 2.3, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATE 42 >gi|319427296|gb|ADV55370.1| TatD-related deoxyribonuclease [Shewanella putrefaciens 200] Length = 254 Score = 35.4 bits (80), Expect = 2.3, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++TH H +FD DR +V+++ HQA + +I Sbjct: 1 MLDTHAHLDFAEFDADRSDVVLKMHQAGIKNLI 33 >gi|167753800|ref|ZP_02425927.1| hypothetical protein ALIPUT_02085 [Alistipes putredinis DSM 17216] gi|167658425|gb|EDS02555.1| hypothetical protein ALIPUT_02085 [Alistipes putredinis DSM 17216] Length = 287 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H +FD DR I RA +A V +++ AI Sbjct: 4 LIDTHSHIYAEEFDADRDEAIRRAREAGVERLLLPAI 40 >gi|291285815|ref|YP_003502633.1| Hydrolase, TatD family [Escherichia coli O55:H7 str. CB9615] gi|290765688|gb|ADD59649.1| Hydrolase, TatD family [Escherichia coli O55:H7 str. CB9615] gi|320643887|gb|EFX13007.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H- str. 493-89] gi|320649045|gb|EFX17627.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H- str. H 2687] gi|320654563|gb|EFX22575.1| putative deoxyribonuclease YjjV [Escherichia coli O55:H7 str. 3256-97 TW 07815] gi|320660276|gb|EFX27780.1| putative deoxyribonuclease YjjV [Escherichia coli O55:H7 str. USDA 5905] gi|320665371|gb|EFX32455.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. LSU-61] Length = 260 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATE 42 >gi|33592246|ref|NP_879890.1| putative deoxyribonuclease [Bordetella pertussis Tohama I] gi|33596667|ref|NP_884310.1| putative deoxyribonuclease [Bordetella parapertussis 12822] gi|33571891|emb|CAE41407.1| putative deoxyribonuclease [Bordetella pertussis Tohama I] gi|33573368|emb|CAE37352.1| putative deoxyribonuclease [Bordetella parapertussis] Length = 275 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI+THCH +FD DR V A +A V ++ A++ Sbjct: 1 MLIDTHCHLDAAEFDADRMAVARAAREAGVQAIVIPAVE 39 >gi|299067170|emb|CBJ38366.1| putative DNAse, hydrolase with metallo-dependent hydrolase domain [Ralstonia solanacearum CMR15] Length = 271 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR VI +A A V ++ AI Sbjct: 1 MWIDTHCHLDAREFDADRDTVIEQARAAGVRHIVVPAI 38 >gi|16763359|ref|NP_458976.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|29144837|ref|NP_808179.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|213161922|ref|ZP_03347632.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] gi|213417865|ref|ZP_03350967.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750] gi|213427568|ref|ZP_03360318.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. E02-1180] gi|213613228|ref|ZP_03371054.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] gi|213647465|ref|ZP_03377518.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. J185] gi|213854148|ref|ZP_03382680.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. M223] gi|25318589|pir||AH1072 conserved hypothetical protein (EC 3.1.21.-) [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|16505668|emb|CAD03399.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] gi|29140476|gb|AAO72039.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] Length = 257 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|167031840|ref|YP_001667071.1| TatD family hydrolase [Pseudomonas putida GB-1] gi|166858328|gb|ABY96735.1| hydrolase, TatD family [Pseudomonas putida GB-1] Length = 258 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR ++ A V +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRSRLLANAAARGVERMVVLGV 39 >gi|33601283|ref|NP_888843.1| putative deoxyribonuclease [Bordetella bronchiseptica RB50] gi|33575718|emb|CAE32796.1| putative deoxyribonuclease [Bordetella bronchiseptica RB50] Length = 275 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI+THCH +FD DR V A +A V ++ A++ Sbjct: 1 MLIDTHCHLDAAEFDADRMAVARAAREAGVQAIVIPAVE 39 >gi|302346895|ref|YP_003815193.1| hydrolase, TatD family [Prevotella melaninogenica ATCC 25845] gi|302150619|gb|ADK96880.1| hydrolase, TatD family [Prevotella melaninogenica ATCC 25845] Length = 271 Score = 35.4 bits (80), Expect = 2.6, Method: Composition-based stats. Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI--AIAIKVIRTLF 45 M+I+TH H + DF +D VI AH+A V K+ AI +K + T+ Sbjct: 1 MIIDTHAHLDVEDFADDLPEVISHAHEAGVGKIFLPAIDLKSVDTVL 47 >gi|167042814|gb|ABZ07532.1| putative TatD related DNase [uncultured marine microorganism HF4000_ANIW137I15] Length = 482 Score = 35.4 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 24/41 (58%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 +++HCH FD+DR V+ RA QA V M+ + ++ + Sbjct: 25 VDSHCHLEDSQFDDDRPGVLERARQAGVRFMMTLGSDILSS 65 >gi|229495481|ref|ZP_04389214.1| hydrolase, TatD family [Porphyromonas endodontalis ATCC 35406] gi|229317464|gb|EEN83364.1| hydrolase, TatD family [Porphyromonas endodontalis ATCC 35406] Length = 261 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I++H H P+FDEDR V+ RA A V +I I V Sbjct: 1 MIDSHTHIFEPEFDEDRREVLERACGAGVEHLILPNIDV 39 >gi|194439278|ref|ZP_03071357.1| hydrolase, TatD family [Escherichia coli 101-1] gi|194421760|gb|EDX37768.1| hydrolase, TatD family [Escherichia coli 101-1] gi|323970827|gb|EGB66079.1| TatD family protein hydrolase [Escherichia coli TA007] Length = 259 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATE 42 >gi|331650864|ref|ZP_08351892.1| putative deoxyribonuclease YjjV [Escherichia coli M718] gi|331051318|gb|EGI23367.1| putative deoxyribonuclease YjjV [Escherichia coli M718] Length = 260 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATE 42 >gi|295676927|ref|YP_003605451.1| TatD-related deoxyribonuclease [Burkholderia sp. CCGE1002] gi|295436770|gb|ADG15940.1| TatD-related deoxyribonuclease [Burkholderia sp. CCGE1002] Length = 262 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V A +A V +++ AI Sbjct: 1 MWIDTHCHLDASEFDADRDAVAASAREAGVSRIVIPAI 38 >gi|168244539|ref|ZP_02669471.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|194448325|ref|YP_002048584.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194406629|gb|ACF66848.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|205336592|gb|EDZ23356.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] Length = 257 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|205355283|ref|YP_002229084.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|205275064|emb|CAR40152.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|326630449|gb|EGE36792.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Gallinarum str. 9] Length = 257 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|322615729|gb|EFY12649.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322620577|gb|EFY17437.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322621796|gb|EFY18646.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322627521|gb|EFY24312.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322630828|gb|EFY27592.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] gi|322637954|gb|EFY34655.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322642224|gb|EFY38832.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322644945|gb|EFY41477.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322656635|gb|EFY52923.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322658707|gb|EFY54964.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322661851|gb|EFY58067.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322666403|gb|EFY62581.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322672441|gb|EFY68553.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322676251|gb|EFY72322.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322679660|gb|EFY75705.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322684370|gb|EFY80374.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|323191852|gb|EFZ77101.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323196677|gb|EFZ81824.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323200946|gb|EFZ86015.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323209343|gb|EFZ94276.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323212970|gb|EFZ97772.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323216713|gb|EGA01438.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323223327|gb|EGA07664.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] gi|323226146|gb|EGA10363.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323228799|gb|EGA12928.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323236590|gb|EGA20666.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323239910|gb|EGA23957.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323242043|gb|EGA26072.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323247516|gb|EGA31471.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323250618|gb|EGA34500.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323259347|gb|EGA42989.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] gi|323263775|gb|EGA47296.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323265631|gb|EGA49127.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323270076|gb|EGA53524.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] Length = 257 Score = 35.0 bits (79), Expect = 3.0, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|207859689|ref|YP_002246340.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|206711492|emb|CAR35877.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] Length = 257 Score = 35.0 bits (79), Expect = 3.0, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|168464518|ref|ZP_02698421.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|195632653|gb|EDX51107.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Newport str. SL317] Length = 257 Score = 35.0 bits (79), Expect = 3.0, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|56416338|ref|YP_153413.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197365260|ref|YP_002144897.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|56130595|gb|AAV80101.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197096737|emb|CAR62360.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] Length = 257 Score = 35.0 bits (79), Expect = 3.1, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|218291060|ref|ZP_03495092.1| hydrolase, TatD family [Alicyclobacillus acidocaldarius LAA1] gi|218239014|gb|EED06220.1| hydrolase, TatD family [Alicyclobacillus acidocaldarius LAA1] Length = 259 Score = 35.0 bits (79), Expect = 3.1, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 25/40 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 L +THCH + F +D +V+ RA +A V +M+ A+ ++ Sbjct: 3 LFDTHCHLMDRRFADDLDDVLARAREAGVERMVVPAVDLV 42 >gi|325858533|ref|ZP_08172637.1| hydrolase, TatD family [Prevotella denticola CRIS 18C-A] gi|327314325|ref|YP_004329762.1| TatD family hydrolase [Prevotella denticola F0289] gi|325483030|gb|EGC86019.1| hydrolase, TatD family [Prevotella denticola CRIS 18C-A] gi|326944183|gb|AEA20068.1| hydrolase, TatD family [Prevotella denticola F0289] Length = 271 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 23/40 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M+I+TH H DF D VI RAH+A V K+ A+ + Sbjct: 1 MIIDTHAHLDTEDFKADLPEVIRRAHEAGVGKIFLPAVDL 40 >gi|194446554|ref|YP_002043805.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194405217|gb|ACF65439.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Newport str. SL254] Length = 257 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|56697580|ref|YP_167949.1| TatD family hydrolase [Ruegeria pomeroyi DSS-3] gi|56679317|gb|AAV95983.1| hydrolase, TatD family [Ruegeria pomeroyi DSS-3] Length = 271 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF+ ++ RA +A V +M+ I ++ Sbjct: 10 ITDSHCHLDFPDFEGQLDEIVARAARAGVTRMVTICTRL 48 >gi|32266821|ref|NP_860853.1| hypothetical protein HH1322 [Helicobacter hepaticus ATCC 51449] gi|32262873|gb|AAP77919.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449] Length = 265 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL 46 +++THCH F+ D VI RA++ NV K+I I IRTL L Sbjct: 8 MVDTHCHLDSQSFENDLEQVIARAYEQNVAKII-IPGADIRTLPL 51 >gi|168234699|ref|ZP_02659757.1| hydrolase, TatD family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|194737126|ref|YP_002117479.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|194712628|gb|ACF91849.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197291890|gb|EDY31240.1| hydrolase, TatD family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] Length = 257 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|168230209|ref|ZP_02655267.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|194471290|ref|ZP_03077274.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|200388450|ref|ZP_03215062.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|194457654|gb|EDX46493.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|199605548|gb|EDZ04093.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|205335015|gb|EDZ21779.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] Length = 257 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|62182982|ref|YP_219399.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|167552211|ref|ZP_02345964.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|168262383|ref|ZP_02684356.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|197250197|ref|YP_002149505.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197265767|ref|ZP_03165841.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|198242234|ref|YP_002218439.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|224586385|ref|YP_002640184.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|62130615|gb|AAX68318.1| putative hydrolase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|197213900|gb|ACH51297.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197244022|gb|EDY26642.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|197936750|gb|ACH74083.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|205323107|gb|EDZ10946.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205348921|gb|EDZ35552.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|224470913|gb|ACN48743.1| hypothetical protein SPC_4700 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|322717489|gb|EFZ09060.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] gi|326626246|gb|EGE32591.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Dublin str. 3246] Length = 257 Score = 35.0 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|16767805|ref|NP_463420.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|167989805|ref|ZP_02570905.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|16423129|gb|AAL23379.1| putative hydrolase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|205331289|gb|EDZ18053.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|267996926|gb|ACY91811.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301161043|emb|CBW20580.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|312915658|dbj|BAJ39632.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|321222467|gb|EFX47539.1| Putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|323132904|gb|ADX20334.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] Length = 257 Score = 35.0 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|238910723|ref|ZP_04654560.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] Length = 257 Score = 35.0 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|168822107|ref|ZP_02834107.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|205341399|gb|EDZ28163.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|320088996|emb|CBY98752.1| putative deoxyribonuclease [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] Length = 257 Score = 35.0 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|309781218|ref|ZP_07675955.1| deoxyribonuclease, TatD family [Ralstonia sp. 5_7_47FAA] gi|308920039|gb|EFP65699.1| deoxyribonuclease, TatD family [Ralstonia sp. 5_7_47FAA] Length = 270 Score = 35.0 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH DFD DR V+ ++ A V ++ A+ Sbjct: 1 MWIDTHCHLDASDFDADRDAVVAQSRAAGVDHIVVPAV 38 >gi|327482268|gb|AEA85578.1| TatD family deoxyribonuclease [Pseudomonas stutzeri DSM 4166] Length = 259 Score = 35.0 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 22/37 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H FD+DR VI RA A V +++ + + Sbjct: 3 LIDTHTHLDFEMFDDDRAQVIARARNAGVERIVVLGV 39 >gi|194246553|ref|YP_002004192.1| Mg-dependent DNase [Candidatus Phytoplasma mali] gi|193806910|emb|CAP18339.1| Mg-dependent DNase [Candidatus Phytoplasma mali] Length = 250 Score = 35.0 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 23/38 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 MLI+TH H D+D D VI+RA +V K+I + + Sbjct: 1 MLIDTHAHLNQSDYDNDLETVILRAFNNDVKKIIVVGM 38 >gi|262280975|ref|ZP_06058758.1| conserved hypothetical protein [Acinetobacter calcoaceticus RUH2202] gi|262257875|gb|EEY76610.1| conserved hypothetical protein [Acinetobacter calcoaceticus RUH2202] Length = 270 Score = 35.0 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L +TH HF + DFDEDR + + A +A V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRQQLALNAKKAGVDALVLIG 38 >gi|146293919|ref|YP_001184343.1| TatD-related deoxyribonuclease [Shewanella putrefaciens CN-32] gi|145565609|gb|ABP76544.1| TatD-related deoxyribonuclease [Shewanella putrefaciens CN-32] Length = 254 Score = 35.0 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++TH H +FD DR V+++ HQA + +I Sbjct: 1 MLDTHAHLDFAEFDADRSEVVLKMHQAGIKNLI 33 >gi|157414088|ref|YP_001484954.1| TatD family deoxyribonuclease [Prochlorococcus marinus str. MIT 9215] gi|157388663|gb|ABV51368.1| possible deoxyribonuclease, TatD family [Prochlorococcus marinus str. MIT 9215] Length = 264 Score = 35.0 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI++HCH + +FD+D +V++R V K++ Sbjct: 6 LIDSHCHLIFENFDKDLEDVVLRLRSRGVKKLV 38 >gi|254525533|ref|ZP_05137585.1| putative deoxyribonuclease, hydrolase [Prochlorococcus marinus str. MIT 9202] gi|221536957|gb|EEE39410.1| putative deoxyribonuclease, hydrolase [Prochlorococcus marinus str. MIT 9202] Length = 264 Score = 35.0 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI++HCH + +FD+D +V++R V K++ Sbjct: 6 LIDSHCHLIFENFDKDLEDVVLRLRSRGVKKLV 38 >gi|262193793|ref|YP_003265002.1| hydrolase, TatD family [Haliangium ochraceum DSM 14365] gi|262077140|gb|ACY13109.1| hydrolase, TatD family [Haliangium ochraceum DSM 14365] Length = 264 Score = 34.7 bits (78), Expect = 3.9, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 21/36 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I++H H DFD DR ++ RAH A V +++ + Sbjct: 3 FIDSHAHIDAADFDSDRPEMLARAHSAGVREIVCVG 38 >gi|207722855|ref|YP_002253289.1| deoxyribonuclease protein [Ralstonia solanacearum MolK2] gi|206588039|emb|CAQ18619.1| deoxyribonuclease protein [Ralstonia solanacearum MolK2] Length = 271 Score = 34.7 bits (78), Expect = 3.9, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V+ +A A V ++ AI Sbjct: 1 MWIDTHCHLDAREFDADRDAVVAQARAAGVRHIVVPAI 38 >gi|194334461|ref|YP_002016321.1| hydrolase, TatD family [Prosthecochloris aestuarii DSM 271] gi|194312279|gb|ACF46674.1| hydrolase, TatD family [Prosthecochloris aestuarii DSM 271] Length = 269 Score = 34.7 bits (78), Expect = 3.9, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ML++ H H P+FD+DR +I R + NV +I Sbjct: 1 MLVDVHSHLSFPEFDQDRPEIIQRMLEHNVGYLI 34 >gi|317120933|ref|YP_004100936.1| hydrolase, TatD family [Thermaerobacter marianensis DSM 12885] gi|315590913|gb|ADU50209.1| hydrolase, TatD family [Thermaerobacter marianensis DSM 12885] Length = 290 Score = 34.7 bits (78), Expect = 4.0, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +L++THCH P+FD DR V+ A A V MI I + V Sbjct: 19 VLVDTHCHLDFPEFDPDRDQVVEAARAAGVAAMITIGVDV 58 >gi|314932713|ref|ZP_07840083.1| deoxyribonuclease, TatD family [Staphylococcus caprae C87] gi|313654543|gb|EFS18295.1| deoxyribonuclease, TatD family [Staphylococcus caprae C87] Length = 256 Score = 34.7 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H +DED + VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDEDLNEVISRAQEAGVDRMFVVG 37 >gi|223044419|ref|ZP_03614452.1| hydrolase, TatD family [Staphylococcus capitis SK14] gi|222442208|gb|EEE48320.1| hydrolase, TatD family [Staphylococcus capitis SK14] Length = 257 Score = 34.7 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H +DED + VI RA +A V +M + Sbjct: 2 MLIDTHVHLNDEQYDEDLNEVISRAQEAGVDRMFVVG 38 >gi|126654256|ref|ZP_01726044.1| TatD related DNase [Bacillus sp. B14905] gi|126589289|gb|EAZ83447.1| TatD related DNase [Bacillus sp. B14905] Length = 256 Score = 34.7 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 M I+TH H ++ED +VI RA +A V KM+ I Sbjct: 1 MFIDTHVHLNADQYEEDLQDVINRALEAKVEKMVVIG 37 >gi|29347466|ref|NP_810969.1| hypothetical protein BT_2056 [Bacteroides thetaiotaomicron VPI-5482] gi|29339366|gb|AAO77163.1| hydrolase, putative [Bacteroides thetaiotaomicron VPI-5482] Length = 258 Score = 34.7 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 MLI+TH H L +F +D V+ RA QA V ++ Sbjct: 1 MLIDTHSHLFLEEFSDDLPQVMERARQAGVSRI 33 >gi|288801180|ref|ZP_06406635.1| deoxyribonuclease, TatD family [Prevotella sp. oral taxon 299 str. F0039] gi|288331791|gb|EFC70274.1| deoxyribonuclease, TatD family [Prevotella sp. oral taxon 299 str. F0039] Length = 261 Score = 34.7 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 22/37 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L++TH H + DF +D V+ RA +A V +M AI Sbjct: 4 LVDTHAHLDVEDFSDDLQQVVQRAKEAGVGRMFLPAI 40 >gi|83748270|ref|ZP_00945296.1| Sec-independent protein translocase protein tatD [Ralstonia solanacearum UW551] gi|207743542|ref|YP_002259934.1| deoxyribonuclease protein [Ralstonia solanacearum IPO1609] gi|83725111|gb|EAP72263.1| Sec-independent protein translocase protein tatD [Ralstonia solanacearum UW551] gi|206594940|emb|CAQ61867.1| deoxyribonuclease protein [Ralstonia solanacearum IPO1609] Length = 271 Score = 34.7 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V+ +A A V ++ AI Sbjct: 1 MWIDTHCHLDAREFDADRDAVVAQARAAGVRHIVVPAI 38 >gi|311107115|ref|YP_003979968.1| TatD related DNAse family protein [Achromobacter xylosoxidans A8] gi|310761804|gb|ADP17253.1| TatD related DNAse family protein [Achromobacter xylosoxidans A8] Length = 272 Score = 34.7 bits (78), Expect = 4.3, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI+THCH +FD DR V A +A+V ++ A++ Sbjct: 1 MLIDTHCHLDAAEFDADREQVADDACEASVQSIVIPAVE 39 >gi|331019106|gb|EGH99162.1| hydrolase, TatD family protein [Pseudomonas syringae pv. lachrymans str. M302278PT] Length = 261 Score = 34.7 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRAQVLKHCRSLGVQRMVVLGV 39 >gi|301383493|ref|ZP_07231911.1| hydrolase, TatD family protein [Pseudomonas syringae pv. tomato Max13] gi|302062508|ref|ZP_07254049.1| hydrolase, TatD family protein [Pseudomonas syringae pv. tomato K40] gi|302134185|ref|ZP_07260175.1| hydrolase, TatD family protein [Pseudomonas syringae pv. tomato NCPPB 1108] Length = 267 Score = 34.7 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +M+ + + Sbjct: 5 LIDTHTHLDFPDFDADRAQVLEHCRSLGVQRMVVLGV 41 >gi|293606102|ref|ZP_06688467.1| hydrogenase nickel insertion protein HypA [Achromobacter piechaudii ATCC 43553] gi|292815557|gb|EFF74673.1| hydrogenase nickel insertion protein HypA [Achromobacter piechaudii ATCC 43553] Length = 272 Score = 34.7 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK-----VIRTL 44 MLI+THCH +FD DR V A +A V ++ AI+ V+R L Sbjct: 1 MLIDTHCHLDAAEFDADRAQVADHACEAGVRSIVIPAIERANFSVVRAL 49 >gi|262163665|ref|ZP_06031406.1| deoxyribonuclease TatD [Vibrio mimicus VM223] gi|262027881|gb|EEY46545.1| deoxyribonuclease TatD [Vibrio mimicus VM223] Length = 255 Score = 34.7 bits (78), Expect = 4.5, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA QA + K++ Sbjct: 1 MIDTHAHIYANEFDHDRDEVIARARQAGIEKIL 33 >gi|258623129|ref|ZP_05718141.1| conserved hypothetical protein [Vibrio mimicus VM573] gi|258584612|gb|EEW09349.1| conserved hypothetical protein [Vibrio mimicus VM573] Length = 255 Score = 34.7 bits (78), Expect = 4.5, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA QA + K++ Sbjct: 1 MIDTHAHIYANEFDHDRDEVIARARQAGIEKIL 33 >gi|258626619|ref|ZP_05721449.1| conserved hypothetical protein [Vibrio mimicus VM603] gi|258581123|gb|EEW06042.1| conserved hypothetical protein [Vibrio mimicus VM603] Length = 255 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA QA + K++ Sbjct: 1 MIDTHAHIYANEFDHDRDEVIARARQAGIEKIL 33 >gi|253570681|ref|ZP_04848089.1| conserved hypothetical protein [Bacteroides sp. 1_1_6] gi|298385076|ref|ZP_06994635.1| hydrolase, TatD family [Bacteroides sp. 1_1_14] gi|251839630|gb|EES67713.1| conserved hypothetical protein [Bacteroides sp. 1_1_6] gi|298262220|gb|EFI05085.1| hydrolase, TatD family [Bacteroides sp. 1_1_14] Length = 258 Score = 34.7 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 MLI+TH H L +F +D V+ RA QA V ++ Sbjct: 1 MLIDTHSHLFLEEFSDDLPQVMERARQAGVSRI 33 >gi|226309674|ref|YP_002769568.1| deoxyribonuclease [Brevibacillus brevis NBRC 100599] gi|226092622|dbj|BAH41064.1| putative deoxyribonuclease [Brevibacillus brevis NBRC 100599] Length = 256 Score = 34.7 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 20/37 (54%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ML TH H +FDEDR VI RA + V ++ I Sbjct: 1 MLFETHAHLNANEFDEDRAEVIARAQENGVSTIVNIG 37 >gi|27469210|ref|NP_765847.1| putative deoxyribonuclease [Staphylococcus epidermidis ATCC 12228] gi|57866028|ref|YP_187725.1| TatD family deoxyribonuclease [Staphylococcus epidermidis RP62A] gi|27316759|gb|AAO05934.1|AE016751_229 putative deoxyribonuclease [Staphylococcus epidermidis ATCC 12228] gi|57636686|gb|AAW53474.1| deoxyribonuclease, TatD family [Staphylococcus epidermidis RP62A] gi|319399648|gb|EFV87902.1| hydrolase, TatD family protein [Staphylococcus epidermidis FRI909] gi|329737897|gb|EGG74125.1| hydrolase, TatD family [Staphylococcus epidermidis VCU045] Length = 256 Score = 34.7 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H +DED + VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMFVVG 37 >gi|300691901|ref|YP_003752896.1| DNAse, hydrolase with metallo-dependent hydrolase domain [Ralstonia solanacearum PSI07] gi|299078961|emb|CBJ51621.1| putative DNAse, hydrolase with metallo-dependent hydrolase domain [Ralstonia solanacearum PSI07] Length = 271 Score = 34.7 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR VI +A A V ++ AI Sbjct: 1 MWIDTHCHLDAREFDADRDAVIEQARAAGVHHIVVPAI 38 >gi|262172864|ref|ZP_06040542.1| deoxyribonuclease TatD [Vibrio mimicus MB-451] gi|261893940|gb|EEY39926.1| deoxyribonuclease TatD [Vibrio mimicus MB-451] Length = 255 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA QA + K++ Sbjct: 1 MIDTHAHIYANEFDHDRDEVIARARQAGIEKIL 33 >gi|260893944|ref|YP_003240041.1| hydrolase, TatD family [Ammonifex degensii KC4] gi|260866085|gb|ACX53191.1| hydrolase, TatD family [Ammonifex degensii KC4] Length = 261 Score = 34.7 bits (78), Expect = 4.7, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 20/36 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI+THCH P + D V+ RA QA V MI + Sbjct: 3 LIDTHCHLNDPRLEADLPEVLARARQAGVKVMIVVG 38 >gi|294101617|ref|YP_003553475.1| hydrolase, TatD family [Aminobacterium colombiense DSM 12261] gi|293616597|gb|ADE56751.1| hydrolase, TatD family [Aminobacterium colombiense DSM 12261] Length = 264 Score = 34.7 bits (78), Expect = 4.7, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++THCH D++ED VI RA + +M+ +A V Sbjct: 7 FVDTHCHLNSEDYNEDLDEVIERAKSQGLARMLVVAADV 45 >gi|329723929|gb|EGG60454.1| hydrolase, TatD family [Staphylococcus epidermidis VCU144] Length = 256 Score = 34.7 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H +DED + VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMFVVG 37 >gi|242371679|ref|ZP_04817253.1| TatD family deoxyribonuclease [Staphylococcus epidermidis M23864:W1] gi|242350628|gb|EES42229.1| TatD family deoxyribonuclease [Staphylococcus epidermidis M23864:W1] Length = 258 Score = 34.7 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H +DED + VI RA +A V +M + Sbjct: 2 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMFVVG 38 >gi|242241576|ref|ZP_04796021.1| TatD family deoxyribonuclease [Staphylococcus epidermidis W23144] gi|293366133|ref|ZP_06612820.1| TatD family deoxyribonuclease [Staphylococcus epidermidis M23864:W2(grey)] gi|242234957|gb|EES37268.1| TatD family deoxyribonuclease [Staphylococcus epidermidis W23144] gi|291319727|gb|EFE60086.1| TatD family deoxyribonuclease [Staphylococcus epidermidis M23864:W2(grey)] Length = 257 Score = 34.7 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H +DED + VI RA +A V +M + Sbjct: 2 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMFVVG 38 >gi|161617876|ref|YP_001591841.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|161367240|gb|ABX71008.1| hypothetical protein SPAB_05743 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] Length = 257 Score = 34.3 bits (77), Expect = 5.0, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERVSIQRACEAGVEKIIVPATE 42 >gi|110680632|ref|YP_683639.1| hypothetical protein RD1_3468 [Roseobacter denitrificans OCh 114] gi|109456748|gb|ABG32953.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] Length = 268 Score = 34.3 bits (77), Expect = 5.0, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF+ V+ A +A V++M+ I K+ Sbjct: 7 ITDSHCHLDFPDFEGRIDEVVANAAEAGVMRMVTICTKL 45 >gi|294649310|ref|ZP_06726744.1| TatD family hydrolase [Acinetobacter haemolyticus ATCC 19194] gi|292824807|gb|EFF83576.1| TatD family hydrolase [Acinetobacter haemolyticus ATCC 19194] Length = 271 Score = 34.3 bits (77), Expect = 5.1, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L +TH HF + DFD+DR + ++A Q V +I I Sbjct: 3 LFDTHTHFDVADFDQDRQQLAVQAKQVGVEALILIG 38 >gi|226952904|ref|ZP_03823368.1| TatD family Mg-dependent DNase [Acinetobacter sp. ATCC 27244] gi|226836349|gb|EEH68732.1| TatD family Mg-dependent DNase [Acinetobacter sp. ATCC 27244] Length = 271 Score = 34.3 bits (77), Expect = 5.4, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L +TH HF + DFD+DR + ++A Q V +I I Sbjct: 3 LFDTHTHFDVADFDQDRQQLAVQAKQVGVEALILIG 38 >gi|330872485|gb|EGH06634.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. morsprunorum str. M302280PT] Length = 266 Score = 34.3 bits (77), Expect = 5.6, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +M+ + + Sbjct: 5 LIDTHTHLDFPDFDADRAQVLEHCRSLGVQRMVVLGV 41 >gi|17545838|ref|NP_519240.1| deoxyribonuclease protein [Ralstonia solanacearum GMI1000] gi|17428132|emb|CAD14821.1| probable deoxyribonuclease protein [Ralstonia solanacearum GMI1000] Length = 271 Score = 34.3 bits (77), Expect = 5.9, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR VI +A A V ++ AI Sbjct: 1 MWIDTHCHLDAREFDADRDAVIEQARVAGVRHIVVPAI 38 >gi|114778161|ref|ZP_01453048.1| TatD-related deoxyribonuclease [Mariprofundus ferrooxydans PV-1] gi|114551579|gb|EAU54133.1| TatD-related deoxyribonuclease [Mariprofundus ferrooxydans PV-1] Length = 258 Score = 34.3 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 26/42 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 L ++HCH FDEDR V R + V +++A+++++ +T Sbjct: 6 LFDSHCHVDFHHFDEDRDAVFERMREQGVTRVLAVSVELEQT 47 >gi|117919487|ref|YP_868679.1| TatD-related deoxyribonuclease [Shewanella sp. ANA-3] gi|117611819|gb|ABK47273.1| TatD-related deoxyribonuclease [Shewanella sp. ANA-3] Length = 255 Score = 34.3 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+++TH H +FD DR V+ R QA + +I Sbjct: 1 MMLDTHAHLDFAEFDSDREQVVQRMRQAGIDNLI 34 >gi|282875421|ref|ZP_06284293.1| hydrolase, TatD family [Staphylococcus epidermidis SK135] gi|281295778|gb|EFA88300.1| hydrolase, TatD family [Staphylococcus epidermidis SK135] gi|329733024|gb|EGG69363.1| hydrolase, TatD family [Staphylococcus epidermidis VCU028] Length = 256 Score = 34.3 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H +DED + VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMCVVG 37 >gi|327398337|ref|YP_004339206.1| TatD family hydrolase [Hippea maritima DSM 10411] gi|327180966|gb|AEA33147.1| hydrolase, TatD family [Hippea maritima DSM 10411] Length = 255 Score = 34.3 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 24/38 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 +I+THCH + +F++DR VI R+ V ++ A++ Sbjct: 4 IIDTHCHIDMEEFEQDRDEVIQRSKAGGVDAILVPAVE 41 >gi|251809799|ref|ZP_04824272.1| TatD family deoxyribonuclease [Staphylococcus epidermidis BCM-HMP0060] gi|251806667|gb|EES59324.1| TatD family deoxyribonuclease [Staphylococcus epidermidis BCM-HMP0060] Length = 257 Score = 34.3 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H +DED + VI RA +A V +M + Sbjct: 2 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMCVVG 38 >gi|188994671|ref|YP_001928923.1| putative DNAse related protein [Porphyromonas gingivalis ATCC 33277] gi|188594351|dbj|BAG33326.1| putative DNAse related protein [Porphyromonas gingivalis ATCC 33277] Length = 275 Score = 34.3 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +LI+TH H P FD+D VI+ A +A ++ ++ I V Sbjct: 10 ILIDTHTHVYEPQFDDDVEQVILAAQEAGLIHLVMPNIDV 49 >gi|171463258|ref|YP_001797371.1| TatD-related deoxyribonuclease [Polynucleobacter necessarius subsp. necessarius STIR1] gi|171192796|gb|ACB43757.1| TatD-related deoxyribonuclease [Polynucleobacter necessarius subsp. necessarius STIR1] Length = 244 Score = 33.9 bits (76), Expect = 6.6, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 23/40 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M I+THCH P+F + VI A + NV ++ A+KV Sbjct: 1 MWIDTHCHLDAPEFADSLPTVIRAAKEKNVKAILLPAVKV 40 >gi|78485065|ref|YP_390990.1| TatD-related deoxyribonuclease [Thiomicrospira crunogena XCL-2] gi|78363351|gb|ABB41316.1| TatD-related deoxyribonuclease [Thiomicrospira crunogena XCL-2] Length = 257 Score = 33.9 bits (76), Expect = 6.7, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Query: 1 MLINTHCHF-LLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M+I++HCH +LP+ VI +AH+ V KM+ IAI Sbjct: 1 MIIDSHCHLNILPEEIGTTEEVIQQAHELGVDKMMCIAI 39 >gi|293610328|ref|ZP_06692629.1| conserved hypothetical protein [Acinetobacter sp. SH024] gi|292827560|gb|EFF85924.1| conserved hypothetical protein [Acinetobacter sp. SH024] Length = 270 Score = 33.9 bits (76), Expect = 6.8, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L +TH HF + DFDEDR + A +A V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRQQLAFNAKKAGVDALVLIG 38 >gi|229520101|ref|ZP_04409529.1| hypothetical protein VIF_000617 [Vibrio cholerae TM 11079-80] gi|229342889|gb|EEO07879.1| hypothetical protein VIF_000617 [Vibrio cholerae TM 11079-80] Length = 255 Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 16/39 (41%), Positives = 22/39 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I+TH H +FD DR VI RA Q + K++ I V Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKILMPNIDV 39 >gi|34540566|ref|NP_905045.1| hydrolase [Porphyromonas gingivalis W83] gi|34396879|gb|AAQ65944.1| hydrolase, putative [Porphyromonas gingivalis W83] Length = 275 Score = 33.9 bits (76), Expect = 7.1, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +LI+TH H P FD+D VI+ A +A ++ ++ I V Sbjct: 10 ILIDTHTHVYEPQFDDDVEQVILAAQEAGLIHLVMPNIDV 49 >gi|326335796|ref|ZP_08201976.1| TatD family deoxyribonuclease [Capnocytophaga sp. oral taxon 338 str. F0234] gi|325692035|gb|EGD33994.1| TatD family deoxyribonuclease [Capnocytophaga sp. oral taxon 338 str. F0234] Length = 256 Score = 33.9 bits (76), Expect = 7.2, Method: Compositional matrix adjust. Identities = 14/38 (36%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M+I+TH H + DFD D V++RA + + + AI Sbjct: 1 MIIDTHTHLYVEDFDTDYQEVVLRAMEQGIKQFFLPAI 38 >gi|309791102|ref|ZP_07685636.1| TatD family hydrolase [Oscillochloris trichoides DG6] gi|308226856|gb|EFO80550.1| TatD family hydrolase [Oscillochloris trichoides DG6] Length = 262 Score = 33.9 bits (76), Expect = 7.3, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 21/36 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI+TH H FD DR V+ RA +A V +MI + Sbjct: 10 LIDTHTHTTAHQFDHDRAAVLQRASEAGVARMIEVG 45 >gi|205372009|ref|ZP_03224827.1| YabD [Bacillus coahuilensis m4-4] Length = 258 Score = 33.9 bits (76), Expect = 7.3, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 21/37 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ML +TH H FD D + VI RA ++ V KM+ + Sbjct: 1 MLFDTHVHLNAEQFDSDLNEVIGRAKESGVEKMVVVG 37 >gi|169825669|ref|YP_001695827.1| putative deoxyribonuclease yabD [Lysinibacillus sphaericus C3-41] gi|168990157|gb|ACA37697.1| Putative deoxyribonuclease yabD [Lysinibacillus sphaericus C3-41] Length = 256 Score = 33.9 bits (76), Expect = 7.5, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 21/37 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 M I+TH H ++ED VI RA +A V KM+ I Sbjct: 1 MFIDTHVHLNADQYEEDLQEVINRALEAKVEKMVVIG 37 >gi|228476218|ref|ZP_04060921.1| hydrolase, TatD family [Staphylococcus hominis SK119] gi|314937302|ref|ZP_07844644.1| deoxyribonuclease, TatD family [Staphylococcus hominis subsp. hominis C80] gi|228269703|gb|EEK11202.1| hydrolase, TatD family [Staphylococcus hominis SK119] gi|313654598|gb|EFS18348.1| deoxyribonuclease, TatD family [Staphylococcus hominis subsp. hominis C80] Length = 256 Score = 33.9 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 21/37 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI+TH H +DED VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDEDLSEVISRAREAGVDRMFVVG 37 >gi|312958917|ref|ZP_07773436.1| TatD-like deoxyribonuclease [Pseudomonas fluorescens WH6] gi|311286687|gb|EFQ65249.1| TatD-like deoxyribonuclease [Pseudomonas fluorescens WH6] Length = 241 Score = 33.9 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ + + V +M+ + + Sbjct: 3 LIDTHTHLDFADFDTDRREVLAHSRELGVRRMVVLGV 39 >gi|229588347|ref|YP_002870466.1| putative deoxyribonuclease [Pseudomonas fluorescens SBW25] gi|229360213|emb|CAY47070.1| putative deoxyribonuclease [Pseudomonas fluorescens SBW25] Length = 258 Score = 33.9 bits (76), Expect = 8.4, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H P FD DR +V+ + V +M+ + + Sbjct: 3 LIDTHTHLDFPAFDSDRRDVLAHSRTLGVRRMVVLGV 39 >gi|78779963|ref|YP_398075.1| putative deoxyribonuclease, TatD family [Prochlorococcus marinus str. MIT 9312] gi|78713462|gb|ABB50639.1| TatD-related deoxyribonuclease [Prochlorococcus marinus str. MIT 9312] Length = 264 Score = 33.9 bits (76), Expect = 8.4, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI++HCH + +FD+D +V+ R V K++ Sbjct: 6 LIDSHCHLIFENFDKDLEDVVCRLRSKGVKKLV 38 >gi|67458628|ref|YP_246252.1| putative deoxyribonuclease, hydrolase [Rickettsia felis URRWXCal2] gi|67004161|gb|AAY61087.1| Putative deoxyribonuclease, hydrolase [Rickettsia felis URRWXCal2] Length = 290 Score = 33.5 bits (75), Expect = 8.6, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 23/40 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++HCH L D D +VI RA + NV M I K+ Sbjct: 1 MLIDSHCHLNLLTKDTDLDSVIQRALENNVQYMQTICTKI 40 >gi|121591870|ref|ZP_01679039.1| hydrolase, TatD family [Vibrio cholerae 2740-80] gi|121546265|gb|EAX56563.1| hydrolase, TatD family [Vibrio cholerae 2740-80] Length = 142 Score = 33.5 bits (75), Expect = 8.7, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKIL 33 >gi|148255486|ref|YP_001240071.1| putative deoxyribonuclease (ycfH) [Bradyrhizobium sp. BTAi1] gi|146407659|gb|ABQ36165.1| Putative deoxyribonuclease (ycfH) [Bradyrhizobium sp. BTAi1] Length = 263 Score = 33.5 bits (75), Expect = 8.8, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF ED ++ RA A V +++ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAEDLDGIVARAAAAGVGRLVTISTRVRR 42 >gi|237802060|ref|ZP_04590521.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. oryzae str. 1_6] gi|331024916|gb|EGI04972.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. oryzae str. 1_6] Length = 266 Score = 33.5 bits (75), Expect = 9.2, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD+DR+ V+ V +M+ + + Sbjct: 5 LIDTHTHLDFSDFDDDRNQVLEHCSSLGVQRMVVLGV 41 >gi|302185876|ref|ZP_07262549.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. syringae 642] Length = 264 Score = 33.5 bits (75), Expect = 9.4, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRARVLDNCRTLGVQRMVVLGV 39 >gi|330967189|gb|EGH67449.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. actinidiae str. M302091] Length = 267 Score = 33.5 bits (75), Expect = 9.7, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +M+ + + Sbjct: 5 LIDTHTHLDFPDFDADRAQVLEHCRSLCVQRMVVLGV 41 >gi|153827720|ref|ZP_01980387.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|149737803|gb|EDM52708.1| conserved hypothetical protein [Vibrio cholerae MZO-2] Length = 255 Score = 33.5 bits (75), Expect = 9.8, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKIL 33 >gi|297581851|ref|ZP_06943772.1| conserved hypothetical protein [Vibrio cholerae RC385] gi|297533945|gb|EFH72785.1| conserved hypothetical protein [Vibrio cholerae RC385] Length = 255 Score = 33.5 bits (75), Expect = 9.9, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKIL 33 >gi|327438101|dbj|BAK14466.1| Mg-dependent DNase [Solibacillus silvestris StLB046] Length = 256 Score = 33.5 bits (75), Expect = 10.0, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 20/36 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I+TH H +DED VI RA ANV KM+ I Sbjct: 4 FIDTHVHLNADQYDEDLQEVIDRAIAANVEKMVVIG 39 >gi|254292251|ref|ZP_04963012.1| conserved hypothetical protein [Vibrio cholerae AM-19226] gi|150421836|gb|EDN13822.1| conserved hypothetical protein [Vibrio cholerae AM-19226] Length = 255 Score = 33.5 bits (75), Expect = 10.0, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKIL 33 >gi|90424204|ref|YP_532574.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris BisB18] gi|90106218|gb|ABD88255.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris BisB18] Length = 263 Score = 33.5 bits (75), Expect = 10.0, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI++HCH PDF +D ++ RA A V +M+ I+ +V R Sbjct: 1 MLIDSHCHLDFPDFADDLDGIVARARAAGVARMVTISTRVRR 42 Searching..................................................done Results from round 2 >gi|325292848|ref|YP_004278712.1| deoxyribonuclease [Agrobacterium sp. H13-3] gi|325060701|gb|ADY64392.1| putative deoxyribonuclease [Agrobacterium sp. H13-3] Length = 260 Score = 73.5 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 30/42 (71%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF+ +R ++I RAH + V +M+ I+ +V R Sbjct: 1 MLIDTHCHLDFPDFEAERDDIIARAHASGVAQMVTISTRVRR 42 >gi|227822151|ref|YP_002826122.1| deoxyribonuclease [Sinorhizobium fredii NGR234] gi|227341151|gb|ACP25369.1| deoxyribonuclease [Sinorhizobium fredii NGR234] Length = 259 Score = 72.7 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 22/42 (52%), Positives = 29/42 (69%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDFD +R +I RA QA V +M+ I+ +V R Sbjct: 1 MLIDTHCHLDFPDFDAERDAIIERARQAGVTQMVTISTRVKR 42 >gi|159184782|ref|NP_354501.2| hypothetical protein Atu1495 [Agrobacterium tumefaciens str. C58] gi|159140070|gb|AAK87286.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 260 Score = 72.7 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 30/42 (71%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF+ +R ++I RAH + V +M+ I+ +V R Sbjct: 1 MLIDTHCHLDFPDFEAERDDIIARAHASGVSQMVTISTRVRR 42 >gi|218463183|ref|ZP_03503274.1| hydrolase, TatD family protein [Rhizobium etli Kim 5] Length = 260 Score = 72.3 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 29/42 (69%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF+ +R ++ RAHQA V +M+ I+ +V + Sbjct: 1 MLIDTHCHLDFADFEAERDEIVTRAHQAGVKQMVTISTRVRK 42 >gi|241204712|ref|YP_002975808.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240858602|gb|ACS56269.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 260 Score = 72.3 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 29/42 (69%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF+ +R ++ RAHQA V +M+ I+ +V + Sbjct: 1 MLIDTHCHLDFADFEAERDEIVARAHQAGVAQMVTISTRVRK 42 >gi|150396507|ref|YP_001326974.1| TatD family hydrolase [Sinorhizobium medicae WSM419] gi|150028022|gb|ABR60139.1| hydrolase, TatD family [Sinorhizobium medicae WSM419] Length = 259 Score = 71.9 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 29/42 (69%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF+ +R +I RA +A V +M+ I+ +V R Sbjct: 1 MLIDTHCHLDFPDFEAERDAIIERAREAGVAQMVTISTRVKR 42 >gi|209549395|ref|YP_002281312.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209535151|gb|ACI55086.1| hydrolase, TatD family [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 260 Score = 71.9 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 29/42 (69%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF+ +R ++ RAHQA V +M+ I+ +V + Sbjct: 1 MLIDTHCHLDFADFEAERDEIVSRAHQAGVKQMVTISTRVRK 42 >gi|116252219|ref|YP_768057.1| DNAse [Rhizobium leguminosarum bv. viciae 3841] gi|115256867|emb|CAK07961.1| putative DNAse [Rhizobium leguminosarum bv. viciae 3841] Length = 260 Score = 71.5 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 29/42 (69%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF+ +R ++ RAH+A V +M+ I+ +V + Sbjct: 1 MLIDTHCHLDFADFEAERDEIVARAHRAGVAQMVTISTRVRK 42 >gi|15965353|ref|NP_385706.1| hypothetical protein SMc01193 [Sinorhizobium meliloti 1021] gi|307312728|ref|ZP_07592359.1| hydrolase, TatD family [Sinorhizobium meliloti BL225C] gi|307317212|ref|ZP_07596653.1| hydrolase, TatD family [Sinorhizobium meliloti AK83] gi|15074533|emb|CAC46179.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] gi|306897300|gb|EFN28045.1| hydrolase, TatD family [Sinorhizobium meliloti AK83] gi|306899453|gb|EFN30085.1| hydrolase, TatD family [Sinorhizobium meliloti BL225C] Length = 259 Score = 70.8 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF+ +R +I RA A V +M+ I+ +V R Sbjct: 1 MLIDTHCHLDFPDFEAERDAIIERARDAGVGQMVTISTRVKR 42 >gi|254469535|ref|ZP_05082940.1| deoxyribonuclease, TatD family [Pseudovibrio sp. JE062] gi|211961370|gb|EEA96565.1| deoxyribonuclease, TatD family [Pseudovibrio sp. JE062] Length = 262 Score = 70.8 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF E+R +I RAH+A V M+ I +V + Sbjct: 3 MLVDSHCHLDFPDFAEERDQIIERAHEAGVKLMVTICTRVRK 44 >gi|163760145|ref|ZP_02167228.1| hypothetical protein HPDFL43_07784 [Hoeflea phototrophica DFL-43] gi|162282544|gb|EDQ32832.1| hypothetical protein HPDFL43_07784 [Hoeflea phototrophica DFL-43] Length = 260 Score = 70.4 bits (171), Expect = 7e-11, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI++HCH DFD +R +I RAH + V +M+ I+ +V + Sbjct: 1 MLIDSHCHLDFADFDAERDELIARAHASGVKQMVTISTRVRK 42 >gi|328543901|ref|YP_004304010.1| Hydrolase, TatD family [Polymorphum gilvum SL003B-26A1] gi|326413645|gb|ADZ70708.1| Hydrolase, TatD family [Polymorphum gilvum SL003B-26A1] Length = 261 Score = 70.0 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDFD +R ++ RAH+A + M+ I +V + Sbjct: 1 MLVDSHCHLDFPDFDGERDALVARAHEAGIGVMVTICTRVRK 42 >gi|218510041|ref|ZP_03507919.1| hydrolase, TatD family protein [Rhizobium etli Brasil 5] Length = 173 Score = 69.2 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 29/42 (69%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF+ +R ++ RAHQA V +M+ I+ +V + Sbjct: 1 MLIDTHCHLDFADFEAERDEIVTRAHQAGVKQMVTISTRVRK 42 >gi|217976727|ref|YP_002360874.1| hydrolase, TatD family [Methylocella silvestris BL2] gi|217502103|gb|ACK49512.1| hydrolase, TatD family [Methylocella silvestris BL2] Length = 267 Score = 68.8 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI++HCH PDF +R VI RA +A V +M+ I+ ++ R Sbjct: 1 MLIDSHCHLDFPDFAAERDAVIQRAREAGVARMVTISTRIER 42 >gi|222086009|ref|YP_002544541.1| deoxyribonuclease protein [Agrobacterium radiobacter K84] gi|221723457|gb|ACM26613.1| deoxyribonuclease protein [Agrobacterium radiobacter K84] Length = 260 Score = 68.1 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF E+R ++ RAH+ V +M+ I+ KV + Sbjct: 1 MLIDTHCHLDFADFAEERDVIVARAHEVGVKQMVTISTKVRK 42 >gi|110633936|ref|YP_674144.1| TatD family hydrolase [Mesorhizobium sp. BNC1] gi|110284920|gb|ABG62979.1| hydrolase, TatD family [Chelativorans sp. BNC1] Length = 264 Score = 67.3 bits (163), Expect = 6e-10, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH PDF+ +R +I RA A V M+ I+ +V Sbjct: 1 MLVDSHCHLDFPDFEAERDQIIARAGDAGVGLMVTISTRVR 41 >gi|312115062|ref|YP_004012658.1| hydrolase, TatD family [Rhodomicrobium vannielii ATCC 17100] gi|311220191|gb|ADP71559.1| hydrolase, TatD family [Rhodomicrobium vannielii ATCC 17100] Length = 269 Score = 66.1 bits (160), Expect = 1e-09, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH P+F+ R +VI RA +A V M+ I+ ++ + Sbjct: 1 MLVDSHCHLDFPEFEPQRDDVIARAREAGVGHMVTISTRIRK 42 >gi|254500560|ref|ZP_05112711.1| hydrolase, TatD family [Labrenzia alexandrii DFL-11] gi|222436631|gb|EEE43310.1| hydrolase, TatD family [Labrenzia alexandrii DFL-11] Length = 270 Score = 65.7 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 M++++HCH PDFD +R +I RA +A V M+ I V + Sbjct: 1 MIVDSHCHLDFPDFDGERDELIARAKEAGVELMVTICTHVRK 42 >gi|254780215|ref|YP_003064628.1| hypothetical protein CLIBASIA_00500 [Candidatus Liberibacter asiaticus str. psy62] gi|254039892|gb|ACT56688.1| hypothetical protein CLIBASIA_00500 [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 65.4 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 37/41 (90%), Positives = 39/41 (95%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 MLI+THCH LLPDFDEDRH+VIMRAHQANVLKMIAIAIKV Sbjct: 1 MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKVK 41 >gi|315122342|ref|YP_004062831.1| hypothetical protein CKC_02970 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495744|gb|ADR52343.1| hypothetical protein CKC_02970 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Score = 65.0 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 32/41 (78%), Positives = 36/41 (87%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 MLI+THCH LPDFD DRH+VIMR+H+A VLKMIAIAIKV Sbjct: 1 MLIDTHCHLALPDFDGDRHDVIMRSHKAGVLKMIAIAIKVK 41 >gi|182678509|ref|YP_001832655.1| TatD family hydrolase [Beijerinckia indica subsp. indica ATCC 9039] gi|182634392|gb|ACB95166.1| hydrolase, TatD family [Beijerinckia indica subsp. indica ATCC 9039] Length = 271 Score = 63.8 bits (154), Expect = 6e-09, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF +R ++ RA A + +MI I+ ++ R Sbjct: 1 MLIDTHCHLDFPDFAAERDEIVGRARAAGLGRMITISTRIDR 42 >gi|27379626|ref|NP_771155.1| hypothetical protein bll4515 [Bradyrhizobium japonicum USDA 110] gi|27352778|dbj|BAC49780.1| bll4515 [Bradyrhizobium japonicum USDA 110] Length = 258 Score = 63.4 bits (153), Expect = 9e-09, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF ED ++ RA A + +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAEDLDGIVSRARAAGIGRMVTISTRVRK 42 >gi|298291757|ref|YP_003693696.1| hydrolase, TatD family [Starkeya novella DSM 506] gi|296928268|gb|ADH89077.1| hydrolase, TatD family [Starkeya novella DSM 506] Length = 257 Score = 63.4 bits (153), Expect = 9e-09, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 M++++HCH PDF + V+ RA A V +M+ I ++ R Sbjct: 1 MIVDSHCHLDFPDFAAELDAVVERARAAGVGRMVTIGTRIRR 42 >gi|254714083|ref|ZP_05175894.1| SEC-independent protein TATD [Brucella ceti M644/93/1] gi|254716861|ref|ZP_05178672.1| SEC-independent protein TATD [Brucella ceti M13/05/1] Length = 263 Score = 62.3 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 42 >gi|261218662|ref|ZP_05932943.1| hydrolase [Brucella ceti M13/05/1] gi|261321840|ref|ZP_05961037.1| hydrolase [Brucella ceti M644/93/1] gi|260923751|gb|EEX90319.1| hydrolase [Brucella ceti M13/05/1] gi|261294530|gb|EEX98026.1| hydrolase [Brucella ceti M644/93/1] Length = 264 Score = 62.3 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 43 >gi|307942272|ref|ZP_07657623.1| TatD family hydrolase [Roseibium sp. TrichSKD4] gi|307774558|gb|EFO33768.1| TatD family hydrolase [Roseibium sp. TrichSKD4] Length = 265 Score = 62.3 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF+ + ++I RAH A V M+ I + + Sbjct: 1 MLVDSHCHLDFPDFEGEHEDLIARAHGAGVGLMVTICTHIRK 42 >gi|306843871|ref|ZP_07476466.1| hydrolase, TatD family [Brucella sp. BO1] gi|306275626|gb|EFM57350.1| hydrolase, TatD family [Brucella sp. BO1] Length = 263 Score = 62.3 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 42 >gi|209964482|ref|YP_002297397.1| hydrolase, TatD family [Rhodospirillum centenum SW] gi|209957948|gb|ACI98584.1| hydrolase, TatD family [Rhodospirillum centenum SW] Length = 264 Score = 62.3 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF E+R V+ RA +A V M+ I R Sbjct: 1 MLVDSHCHLDFPDFQEERDQVVQRAREAGVGLMLTICTHASR 42 >gi|254693712|ref|ZP_05155540.1| SEC-independent protein TATD [Brucella abortus bv. 3 str. Tulya] gi|261213984|ref|ZP_05928265.1| hydrolase [Brucella abortus bv. 3 str. Tulya] gi|260915591|gb|EEX82452.1| hydrolase [Brucella abortus bv. 3 str. Tulya] Length = 263 Score = 62.3 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 42 >gi|23501877|ref|NP_698004.1| TatD family hydrolase [Brucella suis 1330] gi|161618950|ref|YP_001592837.1| TatD family hydrolase [Brucella canis ATCC 23365] gi|254704290|ref|ZP_05166118.1| TatD family hydrolase [Brucella suis bv. 3 str. 686] gi|23347816|gb|AAN29919.1| hydrolase, TatD family [Brucella suis 1330] gi|161335761|gb|ABX62066.1| hydrolase, TatD family [Brucella canis ATCC 23365] Length = 263 Score = 62.3 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 42 >gi|62289920|ref|YP_221713.1| TatD family hydrolase [Brucella abortus bv. 1 str. 9-941] gi|82699847|ref|YP_414421.1| TatD-related deoxyribonuclease [Brucella melitensis biovar Abortus 2308] gi|163843265|ref|YP_001627669.1| TatD family hydrolase [Brucella suis ATCC 23445] gi|225852501|ref|YP_002732734.1| TatD family hydrolase [Brucella melitensis ATCC 23457] gi|254689227|ref|ZP_05152481.1| SEC-independent protein TATD [Brucella abortus bv. 6 str. 870] gi|254697362|ref|ZP_05159190.1| SEC-independent protein TATD [Brucella abortus bv. 2 str. 86/8/59] gi|254701748|ref|ZP_05163576.1| SEC-independent protein TATD [Brucella suis bv. 5 str. 513] gi|254710082|ref|ZP_05171893.1| SEC-independent protein TATD [Brucella pinnipedialis B2/94] gi|254730260|ref|ZP_05188838.1| SEC-independent protein TATD [Brucella abortus bv. 4 str. 292] gi|256031578|ref|ZP_05445192.1| SEC-independent protein TATD [Brucella pinnipedialis M292/94/1] gi|256044656|ref|ZP_05447560.1| SEC-independent protein TATD [Brucella melitensis bv. 1 str. Rev.1] gi|256061088|ref|ZP_05451243.1| SEC-independent protein TATD [Brucella neotomae 5K33] gi|256113543|ref|ZP_05454369.1| SEC-independent protein TATD [Brucella melitensis bv. 3 str. Ether] gi|256159716|ref|ZP_05457463.1| SEC-independent protein TATD [Brucella ceti M490/95/1] gi|256254978|ref|ZP_05460514.1| SEC-independent protein TATD [Brucella ceti B1/94] gi|256257477|ref|ZP_05463013.1| SEC-independent protein TATD [Brucella abortus bv. 9 str. C68] gi|62196052|gb|AAX74352.1| hydrolase, TatD family [Brucella abortus bv. 1 str. 9-941] gi|82615948|emb|CAJ10971.1| TatD-related deoxyribonuclease [Brucella melitensis biovar Abortus 2308] gi|163673988|gb|ABY38099.1| hydrolase, TatD family [Brucella suis ATCC 23445] gi|225640866|gb|ACO00780.1| hydrolase, TatD family protein [Brucella melitensis ATCC 23457] gi|326409017|gb|ADZ66082.1| Sec-independent protein TATD [Brucella melitensis M28] gi|326538727|gb|ADZ86942.1| hydrolase, TatD family protein [Brucella melitensis M5-90] Length = 263 Score = 62.3 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 42 >gi|254719074|ref|ZP_05180885.1| Sec-independent protein TATD [Brucella sp. 83/13] gi|306838356|ref|ZP_07471201.1| hydrolase, TatD family [Brucella sp. NF 2653] gi|306406496|gb|EFM62730.1| hydrolase, TatD family [Brucella sp. NF 2653] Length = 263 Score = 62.3 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 42 >gi|260566463|ref|ZP_05836933.1| sec-independent protein TATD [Brucella suis bv. 4 str. 40] gi|261754958|ref|ZP_05998667.1| hydrolase [Brucella suis bv. 3 str. 686] gi|260155981|gb|EEW91061.1| sec-independent protein TATD [Brucella suis bv. 4 str. 40] gi|261744711|gb|EEY32637.1| hydrolase [Brucella suis bv. 3 str. 686] Length = 264 Score = 61.9 bits (149), Expect = 2e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 43 >gi|239831996|ref|ZP_04680325.1| hydrolase, TatD family [Ochrobactrum intermedium LMG 3301] gi|239824263|gb|EEQ95831.1| hydrolase, TatD family [Ochrobactrum intermedium LMG 3301] Length = 264 Score = 61.9 bits (149), Expect = 2e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 43 >gi|189024162|ref|YP_001934930.1| Sec-independent protein TATD [Brucella abortus S19] gi|260545331|ref|ZP_05821072.1| sec-independent protein TATD [Brucella abortus NCTC 8038] gi|260564002|ref|ZP_05834488.1| sec-independent protein TATD [Brucella melitensis bv. 1 str. 16M] gi|260754732|ref|ZP_05867080.1| hydrolase [Brucella abortus bv. 6 str. 870] gi|260757955|ref|ZP_05870303.1| hydrolase [Brucella abortus bv. 4 str. 292] gi|260761778|ref|ZP_05874121.1| hydrolase [Brucella abortus bv. 2 str. 86/8/59] gi|260883753|ref|ZP_05895367.1| hydrolase [Brucella abortus bv. 9 str. C68] gi|261222164|ref|ZP_05936445.1| hydrolase [Brucella ceti B1/94] gi|261317631|ref|ZP_05956828.1| hydrolase [Brucella pinnipedialis B2/94] gi|261325090|ref|ZP_05964287.1| hydrolase [Brucella neotomae 5K33] gi|261752301|ref|ZP_05996010.1| hydrolase [Brucella suis bv. 5 str. 513] gi|265988666|ref|ZP_06101223.1| hydrolase [Brucella pinnipedialis M292/94/1] gi|265991080|ref|ZP_06103637.1| hydrolase [Brucella melitensis bv. 1 str. Rev.1] gi|265994916|ref|ZP_06107473.1| hydrolase [Brucella melitensis bv. 3 str. Ether] gi|265998129|ref|ZP_06110686.1| hydrolase [Brucella ceti M490/95/1] gi|265999471|ref|ZP_05466540.2| sec-independent protein TATD [Brucella melitensis bv. 2 str. 63/9] gi|297248321|ref|ZP_06932039.1| deoxyribonuclease YcfH [Brucella abortus bv. 5 str. B3196] gi|189019734|gb|ACD72456.1| Sec-independent protein TATD [Brucella abortus S19] gi|260096738|gb|EEW80613.1| sec-independent protein TATD [Brucella abortus NCTC 8038] gi|260154018|gb|EEW89110.1| sec-independent protein TATD [Brucella melitensis bv. 1 str. 16M] gi|260668273|gb|EEX55213.1| hydrolase [Brucella abortus bv. 4 str. 292] gi|260672210|gb|EEX59031.1| hydrolase [Brucella abortus bv. 2 str. 86/8/59] gi|260674840|gb|EEX61661.1| hydrolase [Brucella abortus bv. 6 str. 870] gi|260873281|gb|EEX80350.1| hydrolase [Brucella abortus bv. 9 str. C68] gi|260920748|gb|EEX87401.1| hydrolase [Brucella ceti B1/94] gi|261296854|gb|EEY00351.1| hydrolase [Brucella pinnipedialis B2/94] gi|261301070|gb|EEY04567.1| hydrolase [Brucella neotomae 5K33] gi|261742054|gb|EEY29980.1| hydrolase [Brucella suis bv. 5 str. 513] gi|262552597|gb|EEZ08587.1| hydrolase [Brucella ceti M490/95/1] gi|262766029|gb|EEZ11818.1| hydrolase [Brucella melitensis bv. 3 str. Ether] gi|263001864|gb|EEZ14439.1| hydrolase [Brucella melitensis bv. 1 str. Rev.1] gi|263094152|gb|EEZ18074.1| sec-independent protein TATD [Brucella melitensis bv. 2 str. 63/9] gi|264660863|gb|EEZ31124.1| hydrolase [Brucella pinnipedialis M292/94/1] gi|297175490|gb|EFH34837.1| deoxyribonuclease YcfH [Brucella abortus bv. 5 str. B3196] Length = 264 Score = 61.9 bits (149), Expect = 2e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 43 >gi|148559388|ref|YP_001258937.1| TatD family hydrolase [Brucella ovis ATCC 25840] gi|294852412|ref|ZP_06793085.1| Mg-dependent DNase [Brucella sp. NVSL 07-0026] gi|148370645|gb|ABQ60624.1| hydrolase, TatD family [Brucella ovis ATCC 25840] gi|294821001|gb|EFG38000.1| Mg-dependent DNase [Brucella sp. NVSL 07-0026] Length = 263 Score = 61.9 bits (149), Expect = 2e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 42 >gi|118589862|ref|ZP_01547266.1| hypothetical protein SIAM614_14395 [Stappia aggregata IAM 12614] gi|118437359|gb|EAV43996.1| hypothetical protein SIAM614_14395 [Stappia aggregata IAM 12614] Length = 268 Score = 61.9 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDFD +R ++I RA A V M+ I + + Sbjct: 1 MLVDSHCHLDFPDFDGERADLIARAKAAGVELMVTICTHIRK 42 >gi|306840484|ref|ZP_07473243.1| hydrolase, TatD family [Brucella sp. BO2] gi|306289499|gb|EFM60717.1| hydrolase, TatD family [Brucella sp. BO2] Length = 264 Score = 61.9 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALNAGIKRMVTISTRVRK 43 >gi|265984064|ref|ZP_06096799.1| hydrolase [Brucella sp. 83/13] gi|264662656|gb|EEZ32917.1| hydrolase [Brucella sp. 83/13] Length = 264 Score = 61.9 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 2 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 43 >gi|91977189|ref|YP_569848.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris BisB5] gi|91683645|gb|ABE39947.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris BisB5] Length = 263 Score = 61.9 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI++HCH PDF +D ++ RA + V +M+ I+ +V R Sbjct: 1 MLIDSHCHLDFPDFADDLDGIVARAAASGVGRMVTISTRVRR 42 >gi|17987269|ref|NP_539903.1| SEC-independent protein TATD [Brucella melitensis bv. 1 str. 16M] gi|237815421|ref|ZP_04594419.1| hydrolase, TatD family [Brucella abortus str. 2308 A] gi|17982946|gb|AAL52167.1| sec-independent protein tatd [Brucella melitensis bv. 1 str. 16M] gi|237790258|gb|EEP64468.1| hydrolase, TatD family [Brucella abortus str. 2308 A] Length = 265 Score = 61.9 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 3 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 44 >gi|115524874|ref|YP_781785.1| TatD family hydrolase [Rhodopseudomonas palustris BisA53] gi|115518821|gb|ABJ06805.1| hydrolase, TatD family [Rhodopseudomonas palustris BisA53] Length = 262 Score = 61.5 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF ED ++ RA A V +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAEDLDGIVSRAGAAGVGRMVTISTRVRQ 42 >gi|261758185|ref|ZP_06001894.1| TatD family hydrolase [Brucella sp. F5/99] gi|261738169|gb|EEY26165.1| TatD family hydrolase [Brucella sp. F5/99] Length = 185 Score = 61.5 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 42 >gi|299133887|ref|ZP_07027081.1| hydrolase, TatD family [Afipia sp. 1NLS2] gi|298591723|gb|EFI51924.1| hydrolase, TatD family [Afipia sp. 1NLS2] Length = 264 Score = 61.5 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D ++ RA A V ++I I+ +V R Sbjct: 1 MLVDSHCHLDFPDFADDLDGIVARAEAAGVGRIITISTRVRR 42 >gi|75675653|ref|YP_318074.1| TatD-related deoxyribonuclease [Nitrobacter winogradskyi Nb-255] gi|74420523|gb|ABA04722.1| TatD-related deoxyribonuclease [Nitrobacter winogradskyi Nb-255] Length = 263 Score = 61.1 bits (147), Expect = 4e-08, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 26/41 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH PDF ++ V+ RA A V +M+ I+ +V Sbjct: 1 MLVDSHCHLDFPDFADELDAVVARAEAAGVGRMVTISTRVR 41 >gi|146340772|ref|YP_001205820.1| putative deoxyribonuclease (ycfH) [Bradyrhizobium sp. ORS278] gi|146193578|emb|CAL77595.1| Putative deoxyribonuclease (ycfH) [Bradyrhizobium sp. ORS278] Length = 263 Score = 61.1 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF ED ++ RA A V +++ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAEDLDGIVTRAAAAGVGRLVTISTRVRR 42 >gi|154253554|ref|YP_001414378.1| TatD family hydrolase [Parvibaculum lavamentivorans DS-1] gi|154157504|gb|ABS64721.1| hydrolase, TatD family [Parvibaculum lavamentivorans DS-1] Length = 268 Score = 61.1 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +LI++HCH PDF + V+ RAH+A V M+ I+ KV Sbjct: 5 VLIDSHCHLDFPDFGAEVEEVVARAHEAGVGLMVTISTKV 44 >gi|256369418|ref|YP_003106926.1| hydrolase, TatD family [Brucella microti CCM 4915] gi|255999578|gb|ACU47977.1| hydrolase, TatD family [Brucella microti CCM 4915] Length = 263 Score = 61.1 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML++ HCH DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 1 MLVDGHCHLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 42 >gi|126736699|ref|ZP_01752438.1| TatD-related deoxyribonuclease [Roseobacter sp. CCS2] gi|126713814|gb|EBA10686.1| TatD-related deoxyribonuclease [Roseobacter sp. CCS2] Length = 262 Score = 60.7 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 25/40 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ++++HCH PDFD +R +I RA A V +M+ I K+ Sbjct: 6 IVDSHCHLDFPDFDGERDALIARAIDAGVTRMVTICTKLR 45 >gi|86749799|ref|YP_486295.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris HaA2] gi|86572827|gb|ABD07384.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris HaA2] Length = 265 Score = 60.7 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D ++ RA + V +M+ I+ +V R Sbjct: 3 MLVDSHCHLDFPDFADDLAGIVARAEASGVGRMVTISTRVKR 44 >gi|85715530|ref|ZP_01046511.1| TatD-related deoxyribonuclease [Nitrobacter sp. Nb-311A] gi|85697725|gb|EAQ35601.1| TatD-related deoxyribonuclease [Nitrobacter sp. Nb-311A] Length = 263 Score = 60.4 bits (145), Expect = 7e-08, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 26/41 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH PDF ++ V+ RA A V +M+ I+ +V Sbjct: 1 MLVDSHCHLDYPDFSDELDAVVARAEAAGVGRMVTISTRVR 41 >gi|294676798|ref|YP_003577413.1| TatD-related deoxyribonuclease family protein [Rhodobacter capsulatus SB 1003] gi|294475618|gb|ADE85006.1| TatD-related deoxyribonuclease family protein [Rhodobacter capsulatus SB 1003] Length = 265 Score = 60.4 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 25/41 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +L+++HCH PDF E+ V+ RA A V +M+ I ++ Sbjct: 7 LLVDSHCHLDFPDFAEELPEVVARARAAGVSRMVTICTRLR 47 >gi|163795497|ref|ZP_02189463.1| hydrolase, TatD family protein [alpha proteobacterium BAL199] gi|159179096|gb|EDP63629.1| hydrolase, TatD family protein [alpha proteobacterium BAL199] Length = 268 Score = 60.4 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF + V+ RA +A V++M+ I +V R Sbjct: 1 MLVDSHCHLDFEDFASELDEVVARARRAGVVRMVTIGTRVRR 42 >gi|254706808|ref|ZP_05168636.1| SEC-independent protein TATD [Brucella pinnipedialis M163/99/10] Length = 263 Score = 60.4 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HC+ DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 1 MLVDSHCYLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 42 >gi|221640131|ref|YP_002526393.1| hydrolase, TatD family [Rhodobacter sphaeroides KD131] gi|221160912|gb|ACM01892.1| Hydrolase, TatD family [Rhodobacter sphaeroides KD131] Length = 265 Score = 60.0 bits (144), Expect = 9e-08, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ++++HCH PDFD + +I RA A V +M+ I ++ Sbjct: 9 IVDSHCHLDFPDFDGEHEALIARARAAGVTRMVTICTRLR 48 >gi|92117537|ref|YP_577266.1| TatD-related deoxyribonuclease [Nitrobacter hamburgensis X14] gi|91800431|gb|ABE62806.1| TatD-related deoxyribonuclease [Nitrobacter hamburgensis X14] Length = 263 Score = 60.0 bits (144), Expect = 9e-08, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 26/41 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH PDF +D ++ RA A V +M+ I+ +V Sbjct: 1 MLVDSHCHLDFPDFADDLDGIVSRAEAAGVSRMVTISTRVR 41 >gi|261314275|ref|ZP_05953472.1| hydrolase [Brucella pinnipedialis M163/99/10] gi|261303301|gb|EEY06798.1| hydrolase [Brucella pinnipedialis M163/99/10] Length = 264 Score = 60.0 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HC+ DF+ +R V+ RA A + +M+ I+ +V + Sbjct: 2 MLVDSHCYLDFADFEPERDAVVQRALDAGIKRMVTISTRVRK 43 >gi|126463089|ref|YP_001044203.1| TatD family hydrolase [Rhodobacter sphaeroides ATCC 17029] gi|126104753|gb|ABN77431.1| hydrolase, TatD family [Rhodobacter sphaeroides ATCC 17029] Length = 265 Score = 60.0 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ++++HCH PDFD + +I RA A V +M+ I ++ Sbjct: 9 IVDSHCHLDFPDFDGEHEALIARARAAGVTRMVTICTRLR 48 >gi|84499969|ref|ZP_00998235.1| hydrolase, TatD family protein [Oceanicola batsensis HTCC2597] gi|84391903|gb|EAQ04171.1| hydrolase, TatD family protein [Oceanicola batsensis HTCC2597] Length = 271 Score = 60.0 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 26/39 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDFD++R VI RA +A V +M+ I K+ Sbjct: 8 ITDSHCHLDFPDFDDERDAVIARAIEAGVGRMVTICTKL 46 >gi|77464247|ref|YP_353751.1| putative TatD-related deoxyribonuclease [Rhodobacter sphaeroides 2.4.1] gi|77388665|gb|ABA79850.1| putative TatD-related deoxyribonuclease [Rhodobacter sphaeroides 2.4.1] Length = 265 Score = 60.0 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ++++HCH PDFD + +I RA A V +M+ I ++ Sbjct: 9 IVDSHCHLDFPDFDGEHEALIARARAAGVTRMVTICTRLR 48 >gi|119384878|ref|YP_915934.1| TatD family hydrolase [Paracoccus denitrificans PD1222] gi|119374645|gb|ABL70238.1| hydrolase, TatD family [Paracoccus denitrificans PD1222] Length = 265 Score = 59.6 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 26/41 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +L+++HCH PDF+ ++ ++ RA A V +M+ I ++ Sbjct: 8 LLVDSHCHLDFPDFEGEQAELVARARAAGVTRMVTICTRLR 48 >gi|288958660|ref|YP_003449001.1| Mg-dependent DNase [Azospirillum sp. B510] gi|288910968|dbj|BAI72457.1| Mg-dependent DNase [Azospirillum sp. B510] Length = 264 Score = 59.6 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF E+ V+ RA QA + +M+ I + R Sbjct: 1 MLVDSHCHLDFPDFTEELDAVVDRARQAGIGRMVTICTYISR 42 >gi|154248250|ref|YP_001419208.1| TatD family hydrolase [Xanthobacter autotrophicus Py2] gi|154162335|gb|ABS69551.1| hydrolase, TatD family [Xanthobacter autotrophicus Py2] Length = 273 Score = 59.6 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF + +V+ RA A V ++ I+ +V R Sbjct: 14 MLVDSHCHLDFPDFAAELPDVVARAGAAGVSHLVTISTRVRR 55 >gi|84516818|ref|ZP_01004176.1| hydrolase, TatD family [Loktanella vestfoldensis SKA53] gi|84509286|gb|EAQ05745.1| hydrolase, TatD family [Loktanella vestfoldensis SKA53] Length = 267 Score = 59.2 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF+ +R VI RA A V +M+ I K+ Sbjct: 11 ITDSHCHLDFPDFEGERDAVIARALAAGVTRMVTICTKL 49 >gi|158423802|ref|YP_001525094.1| TatD-related deoxyribonuclease [Azorhizobium caulinodans ORS 571] gi|158330691|dbj|BAF88176.1| TatD-related deoxyribonuclease [Azorhizobium caulinodans ORS 571] Length = 259 Score = 59.2 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF + +V+ RA A V ++ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAAELPDVVARAKAAGVSHLVTISTRVRR 42 >gi|153009410|ref|YP_001370625.1| TatD family hydrolase [Ochrobactrum anthropi ATCC 49188] gi|151561298|gb|ABS14796.1| hydrolase, TatD family [Ochrobactrum anthropi ATCC 49188] Length = 264 Score = 59.2 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH DF+ +R +++ RA A V +M+ I+ +V + Sbjct: 2 MLVDSHCHLDFADFEPERDDIVQRALDARVRRMVTISTRVKK 43 >gi|146276607|ref|YP_001166766.1| TatD family hydrolase [Rhodobacter sphaeroides ATCC 17025] gi|145554848|gb|ABP69461.1| hydrolase, TatD family [Rhodobacter sphaeroides ATCC 17025] Length = 265 Score = 59.2 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ++++HCH PDFD + +I RA A V +M+ I ++ Sbjct: 9 IVDSHCHLDFPDFDGEHAALIERARAAGVTRMVTICTRLR 48 >gi|209885247|ref|YP_002289104.1| putative deoxyribonuclease [Oligotropha carboxidovorans OM5] gi|209873443|gb|ACI93239.1| putative deoxyribonuclease [Oligotropha carboxidovorans OM5] Length = 264 Score = 59.2 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PD+ ++ V+ RA A+V +++ I+ +V R Sbjct: 1 MLVDSHCHLDFPDYGDELDAVVARAEAADVKRIVTISTRVKR 42 >gi|316934060|ref|YP_004109042.1| hydrolase [Rhodopseudomonas palustris DX-1] gi|315601774|gb|ADU44309.1| hydrolase, TatD family [Rhodopseudomonas palustris DX-1] Length = 264 Score = 58.8 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D ++ RA + V +M+ I+ +V + Sbjct: 3 MLVDSHCHLDFPDFADDLAGIVARAEASGVGRMVTISTRVRK 44 >gi|300023245|ref|YP_003755856.1| hydrolase, TatD family [Hyphomicrobium denitrificans ATCC 51888] gi|299525066|gb|ADJ23535.1| hydrolase, TatD family [Hyphomicrobium denitrificans ATCC 51888] Length = 269 Score = 58.8 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML++ HCH P+F + V+ RA +A V M+ I+ ++ + Sbjct: 1 MLVDHHCHLDFPEFAPELDQVVARAREAGVGTMVTISTRIRQ 42 >gi|192291493|ref|YP_001992098.1| hydrolase, TatD family [Rhodopseudomonas palustris TIE-1] gi|192285242|gb|ACF01623.1| hydrolase, TatD family [Rhodopseudomonas palustris TIE-1] Length = 262 Score = 58.8 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D ++ RA + V +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFADDLAGIVARAEASGVGRMVTISTRVRK 42 >gi|39935845|ref|NP_948121.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris CGA009] gi|39649699|emb|CAE28220.1| possible deoxyribonuclease [Rhodopseudomonas palustris CGA009] Length = 262 Score = 58.8 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D ++ RA + V +M+ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFADDLAGIVARAEASGVGRMVTISTRVRK 42 >gi|126726753|ref|ZP_01742593.1| hydrolase, TatD family protein [Rhodobacterales bacterium HTCC2150] gi|126704082|gb|EBA03175.1| hydrolase, TatD family protein [Rhodobacterales bacterium HTCC2150] Length = 261 Score = 58.4 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ++++HCH PDFD + +I RA A V +M+ I ++ Sbjct: 5 IVDSHCHLDFPDFDGEHEALIARAEAAGVKRMVTICTQLE 44 >gi|114770994|ref|ZP_01448434.1| hydrolase, TatD family protein [alpha proteobacterium HTCC2255] gi|114548276|gb|EAU51162.1| hydrolase, TatD family protein [alpha proteobacterium HTCC2255] Length = 262 Score = 58.4 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 27/41 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +++++HCH PDF+ + +++ RA+ A V +M+ I K+ Sbjct: 5 IIVDSHCHLDFPDFEGEIPDLVARANDAGVKRMVTICTKLK 45 >gi|163738561|ref|ZP_02145975.1| hydrolase, TatD family protein [Phaeobacter gallaeciensis BS107] gi|161387889|gb|EDQ12244.1| hydrolase, TatD family protein [Phaeobacter gallaeciensis BS107] Length = 266 Score = 58.4 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDF+ + +I RA +A V +M+ I K+ Sbjct: 5 ITDSHCHLDFPDFEGELDALIARAAEAGVTRMVTICTKLR 44 >gi|254475640|ref|ZP_05089026.1| TatD related DNase [Ruegeria sp. R11] gi|214029883|gb|EEB70718.1| TatD related DNase [Ruegeria sp. R11] Length = 273 Score = 58.4 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDF+ + +I RA +A V +M+ I K+ Sbjct: 12 ITDSHCHLDFPDFEGELDALIARAAEAGVTRMVTICTKLR 51 >gi|144899822|emb|CAM76686.1| TatD-related deoxyribonuclease [Magnetospirillum gryphiswaldense MSR-1] Length = 258 Score = 58.4 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF ++ V+ RA Q+ + M+ I V R Sbjct: 1 MLVDSHCHLDFPDFADELDQVVERARQSGIGLMLTINTHVSR 42 >gi|149201818|ref|ZP_01878792.1| hydrolase, TatD family protein [Roseovarius sp. TM1035] gi|149144866|gb|EDM32895.1| hydrolase, TatD family protein [Roseovarius sp. TM1035] Length = 263 Score = 58.4 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 + ++HCH PDFDE+R VI RA A V +M+ I ++ + Sbjct: 7 ITDSHCHLDFPDFDEERDQVISRAVAAGVHRMVTICTRLDQ 47 >gi|260426719|ref|ZP_05780698.1| hydrolase, TatD family [Citreicella sp. SE45] gi|260421211|gb|EEX14462.1| hydrolase, TatD family [Citreicella sp. SE45] Length = 268 Score = 58.4 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 26/40 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDFDE+R +VI RA A V +M+ I ++ Sbjct: 6 ITDSHCHLDFPDFDEERADVISRAVAAGVHRMVTICTRLR 45 >gi|83593035|ref|YP_426787.1| TatD-related deoxyribonuclease [Rhodospirillum rubrum ATCC 11170] gi|83575949|gb|ABC22500.1| TatD-related deoxyribonuclease [Rhodospirillum rubrum ATCC 11170] Length = 270 Score = 58.0 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 23/42 (54%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 M++++HCH PDF D V+ RA A V M+ I V R Sbjct: 1 MIVDSHCHLDFPDFAPDIDAVVERARTAGVGTMLTICTHVSR 42 >gi|126739766|ref|ZP_01755457.1| hydrolase, TatD family protein [Roseobacter sp. SK209-2-6] gi|126718998|gb|EBA15709.1| hydrolase, TatD family protein [Roseobacter sp. SK209-2-6] Length = 277 Score = 58.0 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 23/40 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDF+ ++ RA +A V +M+ I K+ Sbjct: 16 ITDSHCHLDFPDFEGQLDEIVTRAAEAGVTRMVTICTKLK 55 >gi|254436736|ref|ZP_05050230.1| hydrolase, TatD family [Octadecabacter antarcticus 307] gi|198252182|gb|EDY76496.1| hydrolase, TatD family [Octadecabacter antarcticus 307] Length = 274 Score = 58.0 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 25/40 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ++++HCH DFD +R +VI RA A V +M+ I ++ Sbjct: 15 IVDSHCHLDFADFDAERADVIGRAVDAGVSRMVTICTRLR 54 >gi|114763015|ref|ZP_01442445.1| hydrolase, TatD family protein [Pelagibaca bermudensis HTCC2601] gi|114544339|gb|EAU47347.1| hydrolase, TatD family protein [Roseovarius sp. HTCC2601] Length = 268 Score = 58.0 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 25/41 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ++ ++HCH PDFD +R +VI RA A V +M+ I + Sbjct: 5 LITDSHCHLDFPDFDAERPDVIARAVDAGVHRMVTICTLLR 45 >gi|163743052|ref|ZP_02150435.1| hydrolase, TatD family protein [Phaeobacter gallaeciensis 2.10] gi|161383735|gb|EDQ08121.1| hydrolase, TatD family protein [Phaeobacter gallaeciensis 2.10] Length = 266 Score = 57.7 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDF+ + +I RA +A V +M+ I K+ Sbjct: 5 ITDSHCHLDFPDFEGELDALITRAAEAGVTRMVTICTKLR 44 >gi|254510459|ref|ZP_05122526.1| hydrolase, TatD family [Rhodobacteraceae bacterium KLH11] gi|221534170|gb|EEE37158.1| hydrolase, TatD family [Rhodobacteraceae bacterium KLH11] Length = 268 Score = 57.7 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 23/40 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDFD ++ RA +A V +M+ I K+ Sbjct: 7 ITDSHCHLDFPDFDGQLDEIVARATEAGVTRMVTICTKLR 46 >gi|85706303|ref|ZP_01037397.1| hydrolase, TatD family protein [Roseovarius sp. 217] gi|85669076|gb|EAQ23943.1| hydrolase, TatD family protein [Roseovarius sp. 217] Length = 263 Score = 57.3 bits (137), Expect = 6e-07, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 26/41 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 + ++HCH PDFD++R VI RA A V +M+ I ++ + Sbjct: 7 ITDSHCHLDFPDFDDERDEVITRAVAAGVHRMVTICTRLDQ 47 >gi|254455166|ref|ZP_05068601.1| hydrolase, TatD family [Octadecabacter antarcticus 238] gi|198263576|gb|EDY87848.1| hydrolase, TatD family [Octadecabacter antarcticus 238] Length = 265 Score = 57.3 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 25/40 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ++++HCH DFD +R +VI RA A V +M+ I ++ Sbjct: 6 IVDSHCHLDFSDFDAERADVIARAVDAGVTRMVTICTRLR 45 >gi|49475613|ref|YP_033654.1| hypothetical protein BH08490 [Bartonella henselae str. Houston-1] gi|49238420|emb|CAF27647.1| hypothetical protein BH08490 [Bartonella henselae str. Houston-1] Length = 257 Score = 57.3 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 21/42 (50%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF +D +VI RA ANV +MI I+ V + Sbjct: 1 MLIDTHCHLDFEDFSQDLDDVIQRALDANVKRMITISTHVRK 42 >gi|99078564|ref|YP_611822.1| TatD-related deoxyribonuclease [Ruegeria sp. TM1040] gi|99035702|gb|ABF62560.1| TatD-related deoxyribonuclease [Ruegeria sp. TM1040] Length = 267 Score = 56.9 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDF+ + V+ RA +A V +M+ I K+ Sbjct: 6 ITDSHCHLDFPDFEGELPEVLARAAEAGVTRMVTICTKLK 45 >gi|259415016|ref|ZP_05738938.1| hydrolase, TatD family [Silicibacter sp. TrichCH4B] gi|259348926|gb|EEW60680.1| hydrolase, TatD family [Silicibacter sp. TrichCH4B] Length = 267 Score = 56.9 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDFD + V+ RA +A V +M+ I K+ Sbjct: 6 ITDSHCHLDFPDFDGELPEVLARAAEAGVTRMVTICTKLK 45 >gi|170747933|ref|YP_001754193.1| TatD family hydrolase [Methylobacterium radiotolerans JCM 2831] gi|170654455|gb|ACB23510.1| hydrolase, TatD family [Methylobacterium radiotolerans JCM 2831] Length = 266 Score = 56.5 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI++HCH PDF D VI RA A V M+ IA +V + Sbjct: 1 MLIDSHCHLDFPDFSADLPGVIARARAAGVTGMLTIATRVAK 42 >gi|323136440|ref|ZP_08071522.1| hydrolase, TatD family [Methylocystis sp. ATCC 49242] gi|322398514|gb|EFY01034.1| hydrolase, TatD family [Methylocystis sp. ATCC 49242] Length = 297 Score = 56.5 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH PDF ++ +I RA V +MI I+ + R Sbjct: 35 MLIDTHCHLDFPDFAPEQAEIIARAKARGVGRMITISTHLSR 76 >gi|56697580|ref|YP_167949.1| TatD family hydrolase [Ruegeria pomeroyi DSS-3] gi|56679317|gb|AAV95983.1| hydrolase, TatD family [Ruegeria pomeroyi DSS-3] Length = 271 Score = 56.1 bits (134), Expect = 1e-06, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 23/40 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDF+ ++ RA +A V +M+ I ++ Sbjct: 10 ITDSHCHLDFPDFEGQLDEIVARAARAGVTRMVTICTRLK 49 >gi|296445797|ref|ZP_06887749.1| hydrolase, TatD family [Methylosinus trichosporium OB3b] gi|296256625|gb|EFH03700.1| hydrolase, TatD family [Methylosinus trichosporium OB3b] Length = 281 Score = 56.1 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 22/40 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH PDF ++ VI R V + I I+ V Sbjct: 1 MLIDTHCHLDFPDFAPEQDEVIARGRAQGVARFITISTHV 40 >gi|83954238|ref|ZP_00962958.1| hydrolase, TatD family protein [Sulfitobacter sp. NAS-14.1] gi|83841275|gb|EAP80445.1| hydrolase, TatD family protein [Sulfitobacter sp. NAS-14.1] Length = 272 Score = 56.1 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDFD + +VI RA A V +M+ I K+ Sbjct: 11 ITDSHCHLDFPDFDGELPDVIARAQAAGVTRMVTICTKLK 50 >gi|255264411|ref|ZP_05343753.1| hydrolase, TatD family [Thalassiobium sp. R2A62] gi|255106746|gb|EET49420.1| hydrolase, TatD family [Thalassiobium sp. R2A62] Length = 267 Score = 55.7 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ++++HCH DFD + +I RA +A V +M+ I ++ Sbjct: 6 IVDSHCHLDFEDFDGEHSELIARAAEAGVTRMVTICTRLK 45 >gi|83943049|ref|ZP_00955509.1| hydrolase, TatD family protein [Sulfitobacter sp. EE-36] gi|83846057|gb|EAP83934.1| hydrolase, TatD family protein [Sulfitobacter sp. EE-36] Length = 272 Score = 55.7 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDFD + +VI RA A V +M+ I K+ Sbjct: 11 ITDSHCHLDFPDFDGELPDVIARAQAAGVTRMVTICTKLK 50 >gi|260575559|ref|ZP_05843557.1| hydrolase, TatD family [Rhodobacter sp. SW2] gi|259022202|gb|EEW25500.1| hydrolase, TatD family [Rhodobacter sp. SW2] Length = 263 Score = 55.7 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 25/39 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++++HCH PDFD + +VI RA A V +M+ + ++ Sbjct: 7 IVDSHCHLDFPDFDNELPDVIARARAAGVTRMVTVCTRL 45 >gi|260459473|ref|ZP_05807728.1| hydrolase, TatD family [Mesorhizobium opportunistum WSM2075] gi|259035027|gb|EEW36283.1| hydrolase, TatD family [Mesorhizobium opportunistum WSM2075] Length = 264 Score = 55.7 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF E+R ++ RA A + +M+ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAEERAAIVARAKAAGIGRMVTISTRVKR 42 >gi|304391678|ref|ZP_07373620.1| sec-independent protein tatd [Ahrensia sp. R2A130] gi|303295907|gb|EFL90265.1| sec-independent protein tatd [Ahrensia sp. R2A130] Length = 264 Score = 55.7 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 23/41 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 L+++HCH PDF + VI A + + +M+ I +V + Sbjct: 4 LVDSHCHLDFPDFAPELDAVIESARETGLRRMVTICTRVRK 44 >gi|240141003|ref|YP_002965483.1| putative metallo-dependent hydrolase, putative deoxyribonuclease, TatD family [Methylobacterium extorquens AM1] gi|240010980|gb|ACS42206.1| putative metallo-dependent hydrolase, putative deoxyribonuclease, TatD family [Methylobacterium extorquens AM1] Length = 265 Score = 55.3 bits (132), Expect = 2e-06, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D VI RA +A V +++ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAQDIPGVIARAAEAGVTRLLTISTRVAK 42 >gi|254563517|ref|YP_003070612.1| metallo-dependent hydrolase, deoxyribonuclease, TatD family [Methylobacterium extorquens DM4] gi|254270795|emb|CAX26800.1| putative metallo-dependent hydrolase, putative deoxyribonuclease, TatD family [Methylobacterium extorquens DM4] Length = 265 Score = 55.3 bits (132), Expect = 2e-06, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D VI RA QA V +++ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAQDIPGVIARAAQAGVTRLLTISTRVAK 42 >gi|254467338|ref|ZP_05080749.1| hydrolase, TatD family [Rhodobacterales bacterium Y4I] gi|206688246|gb|EDZ48728.1| hydrolase, TatD family [Rhodobacterales bacterium Y4I] Length = 269 Score = 55.3 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 22/40 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDF+ VI A +A V +M+ I K+ Sbjct: 8 ITDSHCHLDFPDFEGRLDEVIASAAEAGVTRMVTICTKMK 47 >gi|319783482|ref|YP_004142958.1| hydrolase, TatD family [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169370|gb|ADV12908.1| hydrolase, TatD family [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 264 Score = 55.3 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF E+R ++ RA A + +M+ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAEERAAIVARASAAGIGRMVTISTRVKR 42 >gi|13470649|ref|NP_102218.1| hypothetical protein mll0418 [Mesorhizobium loti MAFF303099] gi|14021391|dbj|BAB48004.1| mll0418 [Mesorhizobium loti MAFF303099] Length = 264 Score = 55.0 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF E+R ++ RA A + +M+ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAEERAAIVARAKAAGIGRMVTISTRVKR 42 >gi|163868325|ref|YP_001609534.1| putative deoxyribonuclease [Bartonella tribocorum CIP 105476] gi|161017981|emb|CAK01539.1| putative deoxyribonuclease [Bartonella tribocorum CIP 105476] Length = 257 Score = 55.0 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 21/42 (50%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF +D NVI RA A+V +MI I+ V + Sbjct: 1 MLIDTHCHLDFEDFSQDLDNVIQRALDADVRRMITISTHVRK 42 >gi|188583888|ref|YP_001927333.1| hydrolase, TatD family [Methylobacterium populi BJ001] gi|179347386|gb|ACB82798.1| hydrolase, TatD family [Methylobacterium populi BJ001] Length = 265 Score = 55.0 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D VI RA A V +++ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAQDIPGVIARARDAGVTRLLTISTRVAK 42 >gi|218532445|ref|YP_002423261.1| hydrolase, TatD family [Methylobacterium chloromethanicum CM4] gi|218524748|gb|ACK85333.1| hydrolase, TatD family [Methylobacterium chloromethanicum CM4] Length = 265 Score = 55.0 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 28/42 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D VI RA QA V +++ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAQDIPGVIARAAQAGVTRLLTISTRVAK 42 >gi|159043472|ref|YP_001532266.1| hydrolase [Dinoroseobacter shibae DFL 12] gi|157911232|gb|ABV92665.1| hydrolase [Dinoroseobacter shibae DFL 12] Length = 269 Score = 54.6 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 22/40 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 L+++HCH PDF E + RA A V +M+ I K+ Sbjct: 6 LVDSHCHLDFPDFAETLPETVARAQAAGVARMVTICTKLR 45 >gi|310816871|ref|YP_003964835.1| TatD family hydrolase [Ketogulonicigenium vulgare Y25] gi|308755606|gb|ADO43535.1| TatD family hydrolase [Ketogulonicigenium vulgare Y25] Length = 262 Score = 54.6 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 23/41 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++++HCH DFD +I RA A V +++ I ++ + Sbjct: 7 IVDSHCHLDFADFDGQLDEIIARATAAGVTRLVTICTRLDQ 47 >gi|254463039|ref|ZP_05076455.1| hydrolase, TatD family [Rhodobacterales bacterium HTCC2083] gi|206679628|gb|EDZ44115.1| hydrolase, TatD family [Rhodobacteraceae bacterium HTCC2083] Length = 268 Score = 54.2 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 25/41 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ++ ++HCH DF+ + +++ RA +A V +M+ I ++ Sbjct: 6 LITDSHCHLDFTDFEGELPDILARAAEAGVHRMVTICTRLR 46 >gi|163853583|ref|YP_001641626.1| TatD family hydrolase [Methylobacterium extorquens PA1] gi|163665188|gb|ABY32555.1| hydrolase, TatD family [Methylobacterium extorquens PA1] Length = 265 Score = 53.8 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D VI RA A V +++ I+ +V + Sbjct: 1 MLVDSHCHLDFPDFAQDIPGVIARAADAGVTRLLTISTRVAK 42 >gi|49474217|ref|YP_032259.1| hypothetical protein BQ06080 [Bartonella quintana str. Toulouse] gi|49239721|emb|CAF26100.1| hypothetical protein BQ06080 [Bartonella quintana str. Toulouse] Length = 257 Score = 53.8 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 M I+THCH DF +D +VI RA ANV +MI I+ ++ + Sbjct: 1 MFIDTHCHLDFEDFSQDLDDVIQRALDANVRRMITISTQLRK 42 >gi|319407221|emb|CBI80860.1| putative deoxyribonuclease [Bartonella sp. 1-1C] Length = 257 Score = 53.8 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF +D + +I RA ANV +MI I+ V + Sbjct: 1 MLIDTHCHLDFEDFSQDLNGIIQRALAANVGRMITISTHVHK 42 >gi|240850630|ref|YP_002972030.1| hydrolase, TatD family [Bartonella grahamii as4aup] gi|240267753|gb|ACS51341.1| hydrolase, TatD family [Bartonella grahamii as4aup] Length = 257 Score = 53.8 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 21/42 (50%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF +D NVI RA A+V +MI I+ V + Sbjct: 1 MLIDTHCHLDFEDFSQDLDNVIQRALDADVKRMITISTHVHK 42 >gi|46202671|ref|ZP_00208610.1| COG0084: Mg-dependent DNase [Magnetospirillum magnetotacticum MS-1] Length = 259 Score = 53.0 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 24/42 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D V+ RA A V ++ I V R Sbjct: 1 MLVDSHCHLDFPDFADDLDGVVGRAKAAGVGVLLTIGTHVTR 42 >gi|90417682|ref|ZP_01225594.1| hydrolase, TatD family [Aurantimonas manganoxydans SI85-9A1] gi|90337354|gb|EAS51005.1| hydrolase, TatD family [Aurantimonas manganoxydans SI85-9A1] Length = 264 Score = 53.0 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 24/41 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 L+++HCH PDF EDR ++I RA V + I+ V + Sbjct: 4 LVDSHCHLDFPDFAEDRADLIARAKAEGVGLFVTISTFVSK 44 >gi|126729241|ref|ZP_01745055.1| hydrolase, TatD family protein [Sagittula stellata E-37] gi|126710231|gb|EBA09283.1| hydrolase, TatD family protein [Sagittula stellata E-37] Length = 273 Score = 53.0 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF + R VI RA A V +M+ I K+ Sbjct: 6 ITDSHCHLDFPDFSDSRPEVIARALDAGVHRMVTICTKL 44 >gi|110680632|ref|YP_683639.1| hypothetical protein RD1_3468 [Roseobacter denitrificans OCh 114] gi|109456748|gb|ABG32953.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] Length = 268 Score = 53.0 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 23/40 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDF+ V+ A +A V++M+ I K+ Sbjct: 7 ITDSHCHLDFPDFEGRIDEVVANAAEAGVMRMVTICTKLR 46 >gi|114704622|ref|ZP_01437530.1| hypothetical protein FP2506_06796 [Fulvimarina pelagi HTCC2506] gi|114539407|gb|EAU42527.1| hypothetical protein FP2506_06796 [Fulvimarina pelagi HTCC2506] Length = 265 Score = 53.0 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 26/41 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++++HCH PDF+EDR +I RA +V + I+ KV + Sbjct: 3 IVDSHCHLDFPDFEEDRDALIERASTNDVRLFVTISTKVAK 43 >gi|220926666|ref|YP_002501968.1| hydrolase, TatD family [Methylobacterium nodulans ORS 2060] gi|219951273|gb|ACL61665.1| hydrolase, TatD family [Methylobacterium nodulans ORS 2060] Length = 268 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 22/41 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH P V+ RA A V +M+ I+ +V Sbjct: 1 MLVDSHCHLDFPGLAGRLPEVLERARAAGVTRMVTISTRVR 41 >gi|307545133|ref|YP_003897612.1| hypothetical protein HELO_2543 [Halomonas elongata DSM 2581] gi|307217157|emb|CBV42427.1| hypothetical protein HELO_2543 [Halomonas elongata DSM 2581] Length = 253 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 22/42 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML++ HCH PDF DR V+ RA A V + + A R Sbjct: 1 MLVDAHCHLDFPDFSADRERVLARARAAGVERFVVPATTRER 42 >gi|149914151|ref|ZP_01902682.1| 3-hydroxydecanoyl-ACP dehydratase [Roseobacter sp. AzwK-3b] gi|149811670|gb|EDM71503.1| 3-hydroxydecanoyl-ACP dehydratase [Roseobacter sp. AzwK-3b] Length = 268 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 22/40 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH FD DR V+ RA A V +M+ I K+ Sbjct: 7 ITDSHCHLDFDVFDADRDQVVQRAVDAGVARMVTICTKLR 46 >gi|83311546|ref|YP_421810.1| Mg-dependent DNase [Magnetospirillum magneticum AMB-1] gi|82946387|dbj|BAE51251.1| Mg-dependent DNase [Magnetospirillum magneticum AMB-1] Length = 259 Score = 52.7 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 24/42 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF +D V+ RA A V ++ I V R Sbjct: 1 MLVDSHCHLDFPDFADDLDGVVGRAGAAGVGVLLTIGTHVTR 42 >gi|84683871|ref|ZP_01011774.1| hydrolase, TatD family protein [Maritimibacter alkaliphilus HTCC2654] gi|84668614|gb|EAQ15081.1| hydrolase, TatD family protein [Rhodobacterales bacterium HTCC2654] Length = 262 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH PDF+ +I A +A V +M+ IA K+ Sbjct: 7 ITDSHCHLDFPDFEGQLDEIISHAAEAGVTRMVTIATKL 45 >gi|163732224|ref|ZP_02139670.1| hypothetical protein RLO149_02197 [Roseobacter litoralis Och 149] gi|161394522|gb|EDQ18845.1| hypothetical protein RLO149_02197 [Roseobacter litoralis Och 149] Length = 277 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 22/40 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDF V+ A +A V++M+ I K+ Sbjct: 16 ITDSHCHLDFPDFKGRIDEVVANAAEAGVMRMVTICTKLK 55 >gi|319405651|emb|CBI79274.1| putative deoxyribonuclease [Bartonella sp. AR 15-3] Length = 258 Score = 52.3 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF +D + +I RA ANV +MI I+ + + Sbjct: 2 MLIDTHCHLDFEDFSQDLNGIIQRALTANVGRMITISTHIHK 43 >gi|254485854|ref|ZP_05099059.1| putative deoxyribonuclease YcfH [Roseobacter sp. GAI101] gi|214042723|gb|EEB83361.1| putative deoxyribonuclease YcfH [Roseobacter sp. GAI101] Length = 268 Score = 51.9 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDF ++ +VI RA A V +M+ I K+ Sbjct: 7 ITDSHCHLDFPDFQDELPDVIDRATAAGVTRMVTICTKLK 46 >gi|198283234|ref|YP_002219555.1| TatD family hydrolase [Acidithiobacillus ferrooxidans ATCC 53993] gi|218666863|ref|YP_002425466.1| hydrolase, TatD family [Acidithiobacillus ferrooxidans ATCC 23270] gi|198247755|gb|ACH83348.1| hydrolase, TatD family [Acidithiobacillus ferrooxidans ATCC 53993] gi|218519076|gb|ACK79662.1| hydrolase, TatD family [Acidithiobacillus ferrooxidans ATCC 23270] Length = 257 Score = 51.9 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 24/38 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ML+++HCH DFD DR ++ RA A V +M+ A+ Sbjct: 1 MLVDSHCHLDFEDFDADRSEILARARAAGVGEMLIAAV 38 >gi|297568539|ref|YP_003689883.1| hydrolase, TatD family [Desulfurivibrio alkaliphilus AHT2] gi|296924454|gb|ADH85264.1| hydrolase, TatD family [Desulfurivibrio alkaliphilus AHT2] Length = 277 Score = 51.9 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 18/37 (48%), Positives = 24/37 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+THCH PD+ D V+ RA QA V +MI++ I Sbjct: 19 LIDTHCHLDFPDYQADLEQVVGRAAQAGVRQMISVGI 55 >gi|94264605|ref|ZP_01288389.1| TatD-related deoxyribonuclease [delta proteobacterium MLMS-1] gi|93454959|gb|EAT05196.1| TatD-related deoxyribonuclease [delta proteobacterium MLMS-1] Length = 275 Score = 51.9 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+THCH PD+ D ++ RA Q V ++ + I Sbjct: 18 LIDTHCHLDFPDYAADYDQLLERARQVGVEAVVTVGI 54 >gi|94269741|ref|ZP_01291547.1| TatD-related deoxyribonuclease [delta proteobacterium MLMS-1] gi|93451097|gb|EAT02038.1| TatD-related deoxyribonuclease [delta proteobacterium MLMS-1] Length = 275 Score = 51.5 bits (122), Expect = 3e-05, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+THCH PD+ D ++ RA Q V ++ + I Sbjct: 18 LIDTHCHLDFPDYAADYDQLLERARQVGVEAVVTVGI 54 >gi|121601870|ref|YP_989108.1| TatD family hydrolase [Bartonella bacilliformis KC583] gi|120614047|gb|ABM44648.1| hydrolase, TatD family [Bartonella bacilliformis KC583] Length = 257 Score = 51.5 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 26/42 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF +D VI RA +++ +MI I+ V + Sbjct: 1 MLIDTHCHLDFEDFAQDLDGVIQRALTSDIGRMITISTYVHK 42 >gi|319404211|emb|CBI77804.1| putative deoxyribonuclease [Bartonella rochalimae ATCC BAA-1498] Length = 257 Score = 51.1 bits (121), Expect = 4e-05, Method: Composition-based stats. Identities = 19/38 (50%), Positives = 24/38 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 MLI+THCH DF +D +I RA ANV +MI I+ Sbjct: 1 MLIDTHCHLDFEDFSQDLSGIIQRALAANVGRMITIST 38 >gi|146305818|ref|YP_001186283.1| TatD family hydrolase [Pseudomonas mendocina ymp] gi|145574019|gb|ABP83551.1| hydrolase, TatD family [Pseudomonas mendocina ymp] Length = 259 Score = 51.1 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 22/37 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ R+ V +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRDEVLARSRALGVQRMVVLGV 39 >gi|91773725|ref|YP_566417.1| TatD-related deoxyribonuclease [Methanococcoides burtonii DSM 6242] gi|91712740|gb|ABE52667.1| TatD-related deoxyribonuclease [Methanococcoides burtonii DSM 6242] Length = 281 Score = 51.1 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +I++HCH P F+ DR I RAH A V+KM+ I + Sbjct: 34 VIDSHCHLDFPKFNRDRDKTIERAHNAGVVKMVNSGIDLK 73 >gi|170744505|ref|YP_001773160.1| TatD family hydrolase [Methylobacterium sp. 4-46] gi|168198779|gb|ACA20726.1| hydrolase, TatD family [Methylobacterium sp. 4-46] Length = 270 Score = 50.7 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 24/42 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH E V+ RA +A V +M+ I+ ++ R Sbjct: 1 MLVDSHCHLDFEGLAETLPEVLARARRAGVSRMVTISTRLRR 42 >gi|83949596|ref|ZP_00958329.1| hydrolase, TatD family protein [Roseovarius nubinhibens ISM] gi|83837495|gb|EAP76791.1| hydrolase, TatD family protein [Roseovarius nubinhibens ISM] Length = 267 Score = 50.7 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 23/39 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++HCH P+ ++ V+ RA +A V +M+ I ++ Sbjct: 6 ITDSHCHLDFPELSDELDEVLARAARAGVTRMVTICTRL 44 >gi|89053766|ref|YP_509217.1| TatD-related deoxyribonuclease [Jannaschia sp. CCS1] gi|88863315|gb|ABD54192.1| TatD-related deoxyribonuclease [Jannaschia sp. CCS1] Length = 267 Score = 50.3 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 22/42 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 L+++HCH + +VI RA A V +MI I ++ T Sbjct: 6 LVDSHCHLDFDSLSAELPDVIARALDAGVTRMITICTRLKNT 47 >gi|319943689|ref|ZP_08017970.1| hydrogenase nickel insertion protein HypA [Lautropia mirabilis ATCC 51599] gi|319742922|gb|EFV95328.1| hydrogenase nickel insertion protein HypA [Lautropia mirabilis ATCC 51599] Length = 271 Score = 50.3 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 19/38 (50%), Positives = 25/38 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 MLI+THCH P+FDEDR VI A QA + ++ A+ Sbjct: 1 MLIDTHCHLDAPEFDEDRDAVIAAARQAGLGAIVVPAV 38 >gi|148259917|ref|YP_001234044.1| TatD family hydrolase [Acidiphilium cryptum JF-5] gi|146401598|gb|ABQ30125.1| hydrolase, TatD family [Acidiphilium cryptum JF-5] Length = 257 Score = 50.3 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 MLI++HCH + +R VI RAH+A V +M+ I + ++ Sbjct: 1 MLIDSHCHLDYFT-EAERPAVIARAHEAGVGRMVTIGTSMRQS 42 >gi|326403129|ref|YP_004283210.1| putative deoxyribonuclease [Acidiphilium multivorum AIU301] gi|325049990|dbj|BAJ80328.1| putative deoxyribonuclease [Acidiphilium multivorum AIU301] Length = 257 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 MLI++HCH + +R VI RAH+A V +M+ I + ++ Sbjct: 1 MLIDSHCHLDYFT-EAERPAVIARAHEAGVGRMVTIGTSMRQS 42 >gi|319787346|ref|YP_004146821.1| hydrolase, TatD family [Pseudoxanthomonas suwonensis 11-1] gi|317465858|gb|ADV27590.1| hydrolase, TatD family [Pseudoxanthomonas suwonensis 11-1] Length = 264 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 24/37 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L+++HCH + +FD DR VI RA +A V + + AI Sbjct: 3 LVDSHCHLDVAEFDADRDAVIARAREAGVRRQVVPAI 39 >gi|319408566|emb|CBI82219.1| putative deoxyribonuclease [Bartonella schoenbuchensis R1] Length = 256 Score = 50.0 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 24/41 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 +I+THCH DF +D VI RA +V +MI I+ V + Sbjct: 1 MIDTHCHLDFEDFAQDLDGVIQRALAVDVGRMITISTHVHK 41 >gi|196231867|ref|ZP_03130723.1| hydrolase, TatD family [Chthoniobacter flavus Ellin428] gi|196223989|gb|EDY18503.1| hydrolase, TatD family [Chthoniobacter flavus Ellin428] Length = 270 Score = 49.6 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 21/41 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML +TH H PDF+ D ++ RA A V ++ I + Sbjct: 1 MLFDTHAHLDFPDFENDLDALLARAEAAGVTRINTIGTTIE 41 >gi|73668480|ref|YP_304495.1| sec-independent transport protein TatD [Methanosarcina barkeri str. Fusaro] gi|72395642|gb|AAZ69915.1| sec-independent transport protein TatD [Methanosarcina barkeri str. Fusaro] Length = 257 Score = 49.2 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +I++HCH P F+ DR I+RA +A V+ M+ I + Sbjct: 10 IIDSHCHLDFPKFNRDREETILRAREAGVVGMVNSGISLK 49 >gi|82617403|emb|CAI64314.1| putative DNase [uncultured archaeon] Length = 268 Score = 49.2 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I++HCH P FD DRH VI RA A V +I Sbjct: 20 MMIDSHCHLDFPRFDSDRHEVIERARIAGVDVII 53 >gi|90424204|ref|YP_532574.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris BisB18] gi|90106218|gb|ABD88255.1| TatD-related deoxyribonuclease [Rhodopseudomonas palustris BisB18] Length = 263 Score = 48.8 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 18/42 (42%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI++HCH PDF +D ++ RA A V +M+ I+ +V R Sbjct: 1 MLIDSHCHLDFPDFADDLDGIVARARAAGVARMVTISTRVRR 42 >gi|295689511|ref|YP_003593204.1| hydrolase, TatD family [Caulobacter segnis ATCC 21756] gi|295431414|gb|ADG10586.1| hydrolase, TatD family [Caulobacter segnis ATCC 21756] Length = 259 Score = 48.8 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P F ED+ VI RA +A + M+ I KV Sbjct: 1 MLIDSHVNLHAPQFAEDKDAVIARAREAGIAMMVTICDKV 40 >gi|315499860|ref|YP_004088663.1| hydrolase, tatd family [Asticcacaulis excentricus CB 48] gi|315417872|gb|ADU14512.1| hydrolase, TatD family [Asticcacaulis excentricus CB 48] Length = 258 Score = 48.8 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 25/40 (62%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P +DEDR VI RA +A V M+ I +V Sbjct: 1 MLIDSHVNLHAPQYDEDRDAVIDRAREAGVGLMVNICDRV 40 >gi|330501811|ref|YP_004378680.1| TatD family hydrolase [Pseudomonas mendocina NK-01] gi|328916097|gb|AEB56928.1| TatD family hydrolase [Pseudomonas mendocina NK-01] Length = 259 Score = 48.8 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +TH H PDFD DR V+ R+ V +M+ + + Sbjct: 3 LTDTHTHLDFPDFDADRDEVLARSRALGVQRMVVLGV 39 >gi|16126065|ref|NP_420629.1| urease/pyrimidinase family protein [Caulobacter crescentus CB15] gi|221234835|ref|YP_002517271.1| DNase, TatD family [Caulobacter crescentus NA1000] gi|13423257|gb|AAK23797.1| urease/pyrimidinase family protein [Caulobacter crescentus CB15] gi|220964007|gb|ACL95363.1| DNase, TatD family [Caulobacter crescentus NA1000] Length = 262 Score = 48.8 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P F ED+ VI RA +A + M+ I KV Sbjct: 4 MLIDSHVNLHAPQFAEDKDAVIARAREAGIAMMVTICDKV 43 >gi|148255486|ref|YP_001240071.1| putative deoxyribonuclease (ycfH) [Bradyrhizobium sp. BTAi1] gi|146407659|gb|ABQ36165.1| Putative deoxyribonuclease (ycfH) [Bradyrhizobium sp. BTAi1] Length = 263 Score = 48.4 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 27/42 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH PDF ED ++ RA A V +++ I+ +V R Sbjct: 1 MLVDSHCHLDFPDFAEDLDGIVARAAAAGVGRLVTISTRVRR 42 >gi|85859109|ref|YP_461311.1| sec-independent protein translocase protein [Syntrophus aciditrophicus SB] gi|85722200|gb|ABC77143.1| sec-independent protein translocase protein [Syntrophus aciditrophicus SB] Length = 255 Score = 48.4 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 19/44 (43%), Positives = 27/44 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTL 44 M+I++H H LP+FD DR VI RA +A V ++ I I + L Sbjct: 1 MMIDSHAHLELPEFDSDRDEVIARAKEAGVDAIVTIGIDLDDCL 44 >gi|114327742|ref|YP_744899.1| TatD family deoxyribonuclease [Granulibacter bethesdensis CGDNIH1] gi|114315916|gb|ABI61976.1| DNase, TatD family [Granulibacter bethesdensis CGDNIH1] Length = 255 Score = 48.4 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL 46 MLI++HCH F+ + +++ RA A V +M+ I++++ +T +L Sbjct: 1 MLIDSHCHLDY--FEAELPDLLSRAQAAGVEEMVTISVRLSQTPWL 44 >gi|187928055|ref|YP_001898542.1| TatD-related deoxyribonuclease [Ralstonia pickettii 12J] gi|187724945|gb|ACD26110.1| TatD-related deoxyribonuclease [Ralstonia pickettii 12J] Length = 270 Score = 48.0 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 23/38 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH DFD DR V+ +AH A V ++ A+ Sbjct: 1 MWIDTHCHLDASDFDADRDAVVAQAHAAGVNHIVVPAV 38 >gi|241662662|ref|YP_002981022.1| TatD-like deoxyribonuclease [Ralstonia pickettii 12D] gi|240864689|gb|ACS62350.1| TatD-related deoxyribonuclease [Ralstonia pickettii 12D] Length = 270 Score = 48.0 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 23/38 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH DFD DR V+ +AH A V ++ A+ Sbjct: 1 MWIDTHCHLDASDFDADRDAVVAQAHAAGVNHIVVPAV 38 >gi|254420640|ref|ZP_05034364.1| hydrolase, TatD family [Brevundimonas sp. BAL3] gi|196186817|gb|EDX81793.1| hydrolase, TatD family [Brevundimonas sp. BAL3] Length = 260 Score = 48.0 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P FDEDR VI RA +A V M+ I+ K+ Sbjct: 1 MLIDSHVNLHAPQFDEDRDAVIARAREAGVGLMVEISDKL 40 >gi|21227387|ref|NP_633309.1| Sec-independent transport protein TatD [Methanosarcina mazei Go1] gi|20905749|gb|AAM30981.1| Sec-independent transport protein TatD [Methanosarcina mazei Go1] Length = 257 Score = 48.0 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 23/40 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +I++HCH P F+ DR I RA +A V+ M+ I + Sbjct: 10 IIDSHCHLDFPKFNPDREEAIQRARKAGVVGMVNSGISLK 49 >gi|315644355|ref|ZP_07897495.1| hydrolase, TatD family protein [Paenibacillus vortex V453] gi|315280232|gb|EFU43524.1| hydrolase, TatD family protein [Paenibacillus vortex V453] Length = 254 Score = 47.6 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 19/36 (52%), Positives = 22/36 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H P FDEDR I RA +A V +MI I Sbjct: 1 MLFDTHTHLDAPQFDEDREETIARALEAGVSRMINI 36 >gi|308050570|ref|YP_003914136.1| TatD-related deoxyribonuclease [Ferrimonas balearica DSM 9799] gi|307632760|gb|ADN77062.1| TatD-related deoxyribonuclease [Ferrimonas balearica DSM 9799] Length = 259 Score = 47.6 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 25/38 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 +LI++HCH LP F DR V+ RAH+A V ++ A+ Sbjct: 3 VLIDSHCHLDLPAFCGDRDAVLQRAHKAGVGAIMVPAV 40 >gi|86136159|ref|ZP_01054738.1| hydrolase, TatD family protein [Roseobacter sp. MED193] gi|85827033|gb|EAQ47229.1| hydrolase, TatD family protein [Roseobacter sp. MED193] Length = 269 Score = 47.6 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 23/40 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH PDFD + VI RA A V +M+ I K+ Sbjct: 8 ITDSHCHLDFPDFDGELDAVIARAAAAGVTRMVTICTKLK 47 >gi|255022089|ref|ZP_05294093.1| Putative deoxyribonuclease YcfH [Acidithiobacillus caldus ATCC 51756] gi|254968447|gb|EET26005.1| Putative deoxyribonuclease YcfH [Acidithiobacillus caldus ATCC 51756] Length = 261 Score = 47.6 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 22/37 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L+++HCH DF EDR V+ RA A V ++ A+ Sbjct: 5 LVDSHCHLDFDDFAEDRDAVLARARAAGVEHLLIAAV 41 >gi|89070238|ref|ZP_01157562.1| hydrolase, TatD family protein [Oceanicola granulosus HTCC2516] gi|89044158|gb|EAR50316.1| hydrolase, TatD family protein [Oceanicola granulosus HTCC2516] Length = 267 Score = 47.3 bits (111), Expect = 6e-04, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 26/41 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++++HCH PDF+ + +I RA +A V +M+ I ++ + Sbjct: 6 IVDSHCHLDFPDFEGEHAALIARAAEAGVTRMVTICTRLRQ 46 >gi|253576894|ref|ZP_04854219.1| hydrolase [Paenibacillus sp. oral taxon 786 str. D14] gi|251843761|gb|EES71784.1| hydrolase [Paenibacillus sp. oral taxon 786 str. D14] Length = 257 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 19/36 (52%), Positives = 22/36 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H P FDEDR VI RA + V +MI I Sbjct: 1 MLFDTHTHLDAPQFDEDREEVIARAVEQGVTRMINI 36 >gi|20093397|ref|NP_619472.1| membrane targeting/translocation system protein [Methanosarcina acetivorans C2A] gi|19918767|gb|AAM07952.1| membrane targeting/translocation system protein [Methanosarcina acetivorans C2A] Length = 252 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 23/40 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +I++HCH P F+ DR I RA +A V+ M+ I + Sbjct: 5 IIDSHCHLDFPKFNPDREEAIHRARKAGVVGMVNSGISLK 44 >gi|221632751|ref|YP_002521973.1| TatD-related deoxyribonuclease [Thermomicrobium roseum DSM 5159] gi|221156726|gb|ACM05853.1| TatD-related deoxyribonuclease [Thermomicrobium roseum DSM 5159] Length = 259 Score = 47.3 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 21/42 (50%), Positives = 25/42 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 +L++THCH LPDFD DR VI RA A V + IA R Sbjct: 2 ILVDTHCHLDLPDFDNDRPLVIERARDAGVQGFVLIAFSPTR 43 >gi|297717868|gb|ADI50077.1| putative deoxyribonuclease YcfH [Candidatus Odyssella thessalonicensis L13] Length = 257 Score = 47.3 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 23/40 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH PDF +D V+ RA + ++ I ++ Sbjct: 1 MLVDSHCHLNFPDFKDDLPAVLRRAQLNGIGTLLTINTRL 40 >gi|163746823|ref|ZP_02154180.1| hypothetical protein OIHEL45_15509 [Oceanibulbus indolifex HEL-45] gi|161379937|gb|EDQ04349.1| hypothetical protein OIHEL45_15509 [Oceanibulbus indolifex HEL-45] Length = 268 Score = 47.3 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 20/40 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + ++HCH D VI RA +A V +M+ I ++ Sbjct: 7 ITDSHCHLDFESLAADLPGVIARASEAGVTRMVTICTRLK 46 >gi|91201025|emb|CAJ74083.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] Length = 471 Score = 46.9 bits (110), Expect = 9e-04, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 23/40 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M+I+TH H P++ D +V+ RA +A V +I + + Sbjct: 16 MIIDTHAHLDFPEYKTDLDSVLSRAREAGVGSIINVGTSL 55 >gi|312144345|ref|YP_003995791.1| hydrolase, TatD family [Halanaerobium sp. 'sapolanicus'] gi|311904996|gb|ADQ15437.1| hydrolase, TatD family [Halanaerobium sp. 'sapolanicus'] Length = 255 Score = 46.9 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 25/43 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTL 44 LI+TH H D+D+DR V RA +A V ++I I + ++ Sbjct: 3 LIDTHAHLDFNDYDKDREEVFSRAREAGVEEIINIGADLESSI 45 >gi|332112100|gb|EGJ12076.1| putative TatD related DNase [Rubrivivax benzoatilyticus JA2] Length = 270 Score = 46.9 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V+ RA A V+ + Sbjct: 1 MWIDTHCHLDAAEFDADRDAVVARARSAGVVMQV 34 >gi|90022697|ref|YP_528524.1| putative deoxyribonuclease [Saccharophagus degradans 2-40] gi|89952297|gb|ABD82312.1| TatD-related deoxyribonuclease [Saccharophagus degradans 2-40] Length = 263 Score = 46.9 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCH P FD DR V+ + +A V K++ Sbjct: 6 MIDTHCHIDFPKFDADRQAVLASSLRAGVQKIV 38 >gi|330807495|ref|YP_004351957.1| putative deoxyribonuclease; TatD like proteins [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|327375603|gb|AEA66953.1| putative deoxyribonuclease; TatD like proteins [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 258 Score = 46.5 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR ++ + V +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRPALLAESRAVGVRQMVVLGV 39 >gi|323699421|ref|ZP_08111333.1| hydrolase, TatD family [Desulfovibrio sp. ND132] gi|323459353|gb|EGB15218.1| hydrolase, TatD family [Desulfovibrio desulfuricans ND132] Length = 272 Score = 46.5 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 +++H H L DFDEDR +I RAH + V +++ + Sbjct: 19 VDSHAHLDLEDFDEDREEIIARAHASGVSRIVNV 52 >gi|78189312|ref|YP_379650.1| TatD-related deoxyribonuclease [Chlorobium chlorochromatii CaD3] gi|78171511|gb|ABB28607.1| TatD-related deoxyribonuclease [Chlorobium chlorochromatii CaD3] Length = 268 Score = 46.5 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 23/40 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M I++HCH PDFD DR++V+ R A V +I V Sbjct: 1 MFIDSHCHLSFPDFDADRNDVLQRLQAAKVSLLIDPGTDV 40 >gi|157787034|ref|NP_001099457.1| hypothetical protein LOC289378 [Rattus norvegicus] gi|149041032|gb|EDL94989.1| rCG20352 [Rattus norvegicus] Length = 271 Score = 46.1 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 26/36 (72%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSAPDFDSDLDDVLEKARKANVMALVAVA 40 >gi|319898929|ref|YP_004159022.1| deoxyribonuclease [Bartonella clarridgeiae 73] gi|319402893|emb|CBI76444.1| putative deoxyribonuclease [Bartonella clarridgeiae 73] Length = 256 Score = 46.1 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 MLI+THCH DF +D + +I RA ANV +MI I+ V + Sbjct: 1 MLIDTHCHLNFEDF-QDLNGIIQRALAANVERMITISTHVHK 41 >gi|329925486|ref|ZP_08280360.1| hydrolase, TatD family [Paenibacillus sp. HGF5] gi|328939769|gb|EGG36109.1| hydrolase, TatD family [Paenibacillus sp. HGF5] Length = 254 Score = 46.1 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 19/36 (52%), Positives = 22/36 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H P FDEDR I RA +A V +MI I Sbjct: 1 MLFDTHTHMDAPQFDEDREAAIQRALEAGVTRMINI 36 >gi|325914005|ref|ZP_08176361.1| Mg-dependent DNase [Xanthomonas vesicatoria ATCC 35937] gi|325539774|gb|EGD11414.1| Mg-dependent DNase [Xanthomonas vesicatoria ATCC 35937] Length = 255 Score = 46.1 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 24/37 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH +FD DR VI RA +A V++ + A+ Sbjct: 3 LIDSHCHLDAGEFDHDRPAVIARAREAGVVQQVVPAV 39 >gi|310639498|ref|YP_003944256.1| hydrolase, tatd family [Paenibacillus polymyxa SC2] gi|309244448|gb|ADO54015.1| Hydrolase, TatD family [Paenibacillus polymyxa SC2] Length = 256 Score = 45.7 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 18/35 (51%), Positives = 22/35 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH H P FDEDR VI RA ++ V +MI I Sbjct: 3 LFDTHTHLDAPQFDEDREEVIARAVESGVTRMINI 37 >gi|160900830|ref|YP_001566412.1| TatD-like deoxyribonuclease [Delftia acidovorans SPH-1] gi|160366414|gb|ABX38027.1| TatD-related deoxyribonuclease [Delftia acidovorans SPH-1] Length = 293 Score = 45.7 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCH P+FD DR V +A +A V ++ Sbjct: 25 IDTHCHLDAPEFDADRDAVRAQAAEAGVAHLV 56 >gi|310765167|gb|ADP10117.1| Mg-dependent DNase [Erwinia sp. Ejp617] Length = 258 Score = 45.7 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 24/41 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++THCHF P F D + RA QA V KMIA+++ R Sbjct: 5 FVDTHCHFDFPPFVGDEEASLQRAAQAGVEKMIAVSVSATR 45 >gi|259907336|ref|YP_002647692.1| Mg-dependent DNase [Erwinia pyrifoliae Ep1/96] gi|224962958|emb|CAX54439.1| Mg-dependent DNase [Erwinia pyrifoliae Ep1/96] gi|283477158|emb|CAY73065.1| yjjV [Erwinia pyrifoliae DSM 12163] Length = 258 Score = 45.7 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 24/41 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++THCHF P F D + RA QA V KMIA+++ R Sbjct: 5 FVDTHCHFDFPPFVGDEEASLQRAAQAGVEKMIAVSVSATR 45 >gi|256025297|ref|ZP_05439162.1| putative deoxyribonuclease YjjV [Escherichia sp. 4_1_40B] Length = 259 Score = 45.7 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAEQAGVGKIIVPATEAE 44 >gi|295676927|ref|YP_003605451.1| TatD-related deoxyribonuclease [Burkholderia sp. CCGE1002] gi|295436770|gb|ADG15940.1| TatD-related deoxyribonuclease [Burkholderia sp. CCGE1002] Length = 262 Score = 45.3 bits (106), Expect = 0.002, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V A +A V +++ AI Sbjct: 1 MWIDTHCHLDASEFDADRDAVAASAREAGVSRIVIPAI 38 >gi|120598009|ref|YP_962583.1| TatD-related deoxyribonuclease [Shewanella sp. W3-18-1] gi|120558102|gb|ABM24029.1| TatD-related deoxyribonuclease [Shewanella sp. W3-18-1] Length = 254 Score = 45.3 bits (106), Expect = 0.002, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++TH H +FD DR +V+++ HQA + +I Sbjct: 1 MLDTHAHLDFAEFDADRSDVVLKMHQAGIKNLI 33 >gi|319427296|gb|ADV55370.1| TatD-related deoxyribonuclease [Shewanella putrefaciens 200] Length = 254 Score = 45.3 bits (106), Expect = 0.002, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++TH H +FD DR +V+++ HQA + +I Sbjct: 1 MLDTHAHLDFAEFDADRSDVVLKMHQAGIKNLI 33 >gi|258513471|ref|YP_003189693.1| hydrolase, TatD family [Desulfotomaculum acetoxidans DSM 771] gi|257777176|gb|ACV61070.1| hydrolase, TatD family [Desulfotomaculum acetoxidans DSM 771] Length = 256 Score = 45.3 bits (106), Expect = 0.002, Method: Composition-based stats. Identities = 19/44 (43%), Positives = 26/44 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTL 44 MLI+TH H F++DR VI RA A V+K+I A + +L Sbjct: 1 MLIDTHAHLDHQKFEQDRDEVIARAGTAGVVKIINAAGDIESSL 44 >gi|308066861|ref|YP_003868466.1| Putative deoxyribonuclease yabD [Paenibacillus polymyxa E681] gi|305856140|gb|ADM67928.1| Putative deoxyribonuclease yabD [Paenibacillus polymyxa E681] Length = 256 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 18/35 (51%), Positives = 22/35 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH H P FDEDR VI RA ++ V +MI I Sbjct: 3 LFDTHTHLDAPQFDEDREEVIARAVESGVTRMINI 37 >gi|146293919|ref|YP_001184343.1| TatD-related deoxyribonuclease [Shewanella putrefaciens CN-32] gi|145565609|gb|ABP76544.1| TatD-related deoxyribonuclease [Shewanella putrefaciens CN-32] Length = 254 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++TH H +FD DR V+++ HQA + +I Sbjct: 1 MLDTHAHLDFAEFDADRSEVVLKMHQAGIKNLI 33 >gi|326804010|ref|YP_004321828.1| hydrolase, TatD family [Aerococcus urinae ACS-120-V-Col10a] gi|326650483|gb|AEA00666.1| hydrolase, TatD family [Aerococcus urinae ACS-120-V-Col10a] Length = 265 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 20/33 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 ML +TH HF DFDEDR I RA QA V M Sbjct: 1 MLFDTHTHFNTADFDEDRDQAIERARQAGVSGM 33 >gi|325495910|gb|EGC93769.1| deoxyribonuclease YjjV [Escherichia fergusonii ECD227] Length = 260 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 6 IDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|330428036|gb|AEC19370.1| Mg-dependent DNase [Pusillimonas sp. T7-7] Length = 272 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI+THCH +F DR VI RA + V ++ Sbjct: 1 MLIDTHCHLDAAEFAADRSAVIERAGEEGVGAIV 34 >gi|218551680|ref|YP_002385472.1| deoxyribonuclease YjjV [Escherichia fergusonii ATCC 35469] gi|218359222|emb|CAQ91888.1| putative DNase [Escherichia fergusonii ATCC 35469] Length = 260 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 6 IDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|124268244|ref|YP_001022248.1| putative TatD related DNase [Methylibium petroleiphilum PM1] gi|124261019|gb|ABM96013.1| putative TatD related DNase [Methylibium petroleiphilum PM1] Length = 284 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 20/31 (64%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +THCH P+FD DR V+ RA A V +++ Sbjct: 12 DTHCHLDAPEFDADRTAVVERARHAGVTQIV 42 >gi|300939363|ref|ZP_07154031.1| hydrolase, TatD family [Escherichia coli MS 21-1] gi|300455767|gb|EFK19260.1| hydrolase, TatD family [Escherichia coli MS 21-1] Length = 259 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|300918462|ref|ZP_07135059.1| hydrolase, TatD family [Escherichia coli MS 115-1] gi|300946762|ref|ZP_07161010.1| hydrolase, TatD family [Escherichia coli MS 116-1] gi|300959106|ref|ZP_07171192.1| hydrolase, TatD family [Escherichia coli MS 175-1] gi|284924557|emb|CBG37696.1| putative deoxyribonuclease [Escherichia coli 042] gi|300314254|gb|EFJ64038.1| hydrolase, TatD family [Escherichia coli MS 175-1] gi|300414385|gb|EFJ97695.1| hydrolase, TatD family [Escherichia coli MS 115-1] gi|300453586|gb|EFK17206.1| hydrolase, TatD family [Escherichia coli MS 116-1] gi|315616254|gb|EFU96873.1| uncharacterized deoxyribonuclease yjjV [Escherichia coli 3431] gi|323960152|gb|EGB55796.1| TatD family protein hydrolase [Escherichia coli H489] Length = 260 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|170021662|ref|YP_001726616.1| putative deoxyribonuclease YjjV [Escherichia coli ATCC 8739] gi|193070599|ref|ZP_03051537.1| hydrolase, TatD family [Escherichia coli E110019] gi|254037389|ref|ZP_04871466.1| hydrolase [Escherichia sp. 1_1_43] gi|260858553|ref|YP_003232444.1| putative DNase [Escherichia coli O26:H11 str. 11368] gi|300905365|ref|ZP_07123135.1| hydrolase, TatD family [Escherichia coli MS 84-1] gi|300928483|ref|ZP_07144010.1| hydrolase, TatD family [Escherichia coli MS 187-1] gi|301022281|ref|ZP_07186179.1| hydrolase, TatD family [Escherichia coli MS 196-1] gi|301303479|ref|ZP_07209602.1| hydrolase, TatD family [Escherichia coli MS 124-1] gi|307313687|ref|ZP_07593306.1| TatD-related deoxyribonuclease [Escherichia coli W] gi|169756590|gb|ACA79289.1| TatD-related deoxyribonuclease [Escherichia coli ATCC 8739] gi|192956082|gb|EDV86547.1| hydrolase, TatD family [Escherichia coli E110019] gi|226840495|gb|EEH72497.1| hydrolase [Escherichia sp. 1_1_43] gi|257757202|dbj|BAI28704.1| predicted DNase [Escherichia coli O26:H11 str. 11368] gi|299881331|gb|EFI89542.1| hydrolase, TatD family [Escherichia coli MS 196-1] gi|300402774|gb|EFJ86312.1| hydrolase, TatD family [Escherichia coli MS 84-1] gi|300463518|gb|EFK27011.1| hydrolase, TatD family [Escherichia coli MS 187-1] gi|300841206|gb|EFK68966.1| hydrolase, TatD family [Escherichia coli MS 124-1] gi|306906510|gb|EFN37023.1| TatD-related deoxyribonuclease [Escherichia coli W] gi|315063681|gb|ADT78008.1| predicted DNase [Escherichia coli W] gi|315255763|gb|EFU35731.1| hydrolase, TatD family [Escherichia coli MS 85-1] gi|320200506|gb|EFW75092.1| Putative deoxyribonuclease YjjV [Escherichia coli EC4100B] gi|323157734|gb|EFZ43839.1| hypothetical protein ECEPECA14_0428 [Escherichia coli EPECa14] gi|323171390|gb|EFZ57037.1| hypothetical protein ECLT68_4033 [Escherichia coli LT-68] gi|323380238|gb|ADX52506.1| TatD-related deoxyribonuclease [Escherichia coli KO11] gi|323935221|gb|EGB31581.1| TatD family protein hydrolase [Escherichia coli E1520] gi|324118332|gb|EGC12226.1| TatD family protein hydrolase [Escherichia coli E1167] Length = 260 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|323964780|gb|EGB60248.1| TatD family protein hydrolase [Escherichia coli M863] gi|327250001|gb|EGE61731.1| hypothetical protein ECSTEC7V_5163 [Escherichia coli STEC_7v] Length = 260 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|331681362|ref|ZP_08381999.1| putative deoxyribonuclease YjjV [Escherichia coli H299] gi|331081583|gb|EGI52744.1| putative deoxyribonuclease YjjV [Escherichia coli H299] Length = 259 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|110644815|ref|YP_672545.1| putative deoxyribonuclease YjjV [Escherichia coli 536] gi|191173142|ref|ZP_03034674.1| hydrolase, TatD family [Escherichia coli F11] gi|300983958|ref|ZP_07176809.1| hydrolase, TatD family [Escherichia coli MS 200-1] gi|306815426|ref|ZP_07449575.1| putative deoxyribonuclease YjjV [Escherichia coli NC101] gi|110346407|gb|ABG72644.1| putative deoxyribonuclease YjjV [Escherichia coli 536] gi|190906527|gb|EDV66134.1| hydrolase, TatD family [Escherichia coli F11] gi|300306792|gb|EFJ61312.1| hydrolase, TatD family [Escherichia coli MS 200-1] gi|305851088|gb|EFM51543.1| putative deoxyribonuclease YjjV [Escherichia coli NC101] gi|324012384|gb|EGB81603.1| hydrolase, TatD family [Escherichia coli MS 60-1] Length = 259 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|187732308|ref|YP_001883041.1| putative deoxyribonuclease YjjV [Shigella boydii CDC 3083-94] gi|187429300|gb|ACD08574.1| hydrolase, TatD family [Shigella boydii CDC 3083-94] gi|320176882|gb|EFW51910.1| putative deoxyribonuclease YjjV [Shigella dysenteriae CDC 74-1112] Length = 260 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|103486746|ref|YP_616307.1| TatD-related deoxyribonuclease [Sphingopyxis alaskensis RB2256] gi|98976823|gb|ABF52974.1| TatD-related deoxyribonuclease [Sphingopyxis alaskensis RB2256] Length = 258 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 21/39 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 ML+++HCH E + V+ RA + V M+ IA + Sbjct: 1 MLVDSHCHLNYKGLAEQQDEVLARARERGVTAMLNIATR 39 >gi|323975863|gb|EGB70959.1| TatD family protein hydrolase [Escherichia coli TW10509] Length = 260 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|24372794|ref|NP_716836.1| TatD family hydrolase [Shewanella oneidensis MR-1] gi|24346882|gb|AAN54281.1|AE015565_4 hydrolase, TatD family [Shewanella oneidensis MR-1] Length = 256 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+++TH H +FD DR +V+ R Q + +I Sbjct: 2 MMLDTHAHLDFSEFDADRDDVVQRMRQVGIDNLI 35 >gi|74314813|ref|YP_313232.1| putative deoxyribonuclease YjjV [Shigella sonnei Ss046] gi|73858290|gb|AAZ90997.1| Mg-dependent DNase [Shigella sonnei Ss046] gi|323166186|gb|EFZ51964.1| hypothetical protein SS53G_3549 [Shigella sonnei 53G] Length = 260 Score = 45.3 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|324112631|gb|EGC06608.1| TatD family protein hydrolase [Escherichia fergusonii B253] Length = 260 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEANLQRAAQAGVGKIIVPATEAE 44 >gi|89111086|ref|AP_004866.1| predicted DNase [Escherichia coli str. K-12 substr. W3110] gi|90111745|ref|YP_026291.2| predicted DNase [Escherichia coli str. K-12 substr. MG1655] gi|170083764|ref|YP_001733084.1| DNase [Escherichia coli str. K-12 substr. DH10B] gi|218561609|ref|YP_002394522.1| deoxyribonuclease YjjV [Escherichia coli S88] gi|238903465|ref|YP_002929261.1| putative DNase [Escherichia coli BW2952] gi|253774992|ref|YP_003037823.1| deoxyribonuclease YjjV [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254164304|ref|YP_003047414.1| putative deoxyribonuclease YjjV [Escherichia coli B str. REL606] gi|297518543|ref|ZP_06936929.1| putative deoxyribonuclease YjjV [Escherichia coli OP50] gi|312970068|ref|ZP_07784250.1| uncharacterized deoxyribonuclease yjjV [Escherichia coli 1827-70] gi|1176481|sp|P39408|YJJV_ECOLI RecName: Full=Uncharacterized deoxyribonuclease yjjV gi|71042572|pdb|1ZZM|A Chain A, Crystal Structure Of Yjjv, Tatd Homolog From Escherichia Coli K12, At 1.8 A Resolution gi|85677117|dbj|BAE78367.1| predicted DNase [Escherichia coli str. K12 substr. W3110] gi|87082439|gb|AAC77331.2| predicted DNase [Escherichia coli str. K-12 substr. MG1655] gi|169891599|gb|ACB05306.1| predicted DNase [Escherichia coli str. K-12 substr. DH10B] gi|218368378|emb|CAR06198.1| putative DNase [Escherichia coli S88] gi|238862336|gb|ACR64334.1| predicted DNase [Escherichia coli BW2952] gi|242379900|emb|CAQ34737.1| predicted DNase [Escherichia coli BL21(DE3)] gi|253326036|gb|ACT30638.1| TatD-related deoxyribonuclease [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253976207|gb|ACT41878.1| predicted DNase [Escherichia coli B str. REL606] gi|253980364|gb|ACT46034.1| predicted DNase [Escherichia coli BL21(DE3)] gi|260450811|gb|ACX41233.1| TatD-related deoxyribonuclease [Escherichia coli DH1] gi|310337566|gb|EFQ02677.1| uncharacterized deoxyribonuclease yjjV [Escherichia coli 1827-70] gi|315138931|dbj|BAJ46090.1| putative deoxyribonuclease YjjV [Escherichia coli DH1] Length = 259 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|188492291|ref|ZP_02999561.1| hydrolase, TatD family [Escherichia coli 53638] gi|188487490|gb|EDU62593.1| hydrolase, TatD family [Escherichia coli 53638] Length = 260 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|26251267|ref|NP_757307.1| putative deoxyribonuclease YjjV [Escherichia coli CFT073] gi|91214093|ref|YP_544079.1| putative deoxyribonuclease YjjV [Escherichia coli UTI89] gi|218692766|ref|YP_002400978.1| putative deoxyribonuclease YjjV [Escherichia coli ED1a] gi|218703125|ref|YP_002410754.1| putative deoxyribonuclease YjjV [Escherichia coli IAI39] gi|227885135|ref|ZP_04002940.1| deoxyribonuclease YjjV [Escherichia coli 83972] gi|300980816|ref|ZP_07175197.1| hydrolase, TatD family [Escherichia coli MS 45-1] gi|301048342|ref|ZP_07195372.1| hydrolase, TatD family [Escherichia coli MS 185-1] gi|331661009|ref|ZP_08361941.1| putative deoxyribonuclease YjjV [Escherichia coli TA206] gi|26111700|gb|AAN83881.1|AE016772_59 Putative deoxyribonuclease yjjV [Escherichia coli CFT073] gi|91075667|gb|ABE10548.1| putative deoxyribonuclease YjjV [Escherichia coli UTI89] gi|218373111|emb|CAR21003.1| putative DNase [Escherichia coli IAI39] gi|218430330|emb|CAR11200.1| putative DNase [Escherichia coli ED1a] gi|222036120|emb|CAP78865.1| Uncharacterized deoxyribonuclease yjjV [Escherichia coli LF82] gi|227837964|gb|EEJ48430.1| deoxyribonuclease YjjV [Escherichia coli 83972] gi|294493243|gb|ADE91999.1| hydrolase, TatD family [Escherichia coli IHE3034] gi|300299802|gb|EFJ56187.1| hydrolase, TatD family [Escherichia coli MS 185-1] gi|300409133|gb|EFJ92671.1| hydrolase, TatD family [Escherichia coli MS 45-1] gi|307556611|gb|ADN49386.1| putative deoxyribonuclease YjjV [Escherichia coli ABU 83972] gi|307629547|gb|ADN73851.1| putative deoxyribonuclease YjjV [Escherichia coli UM146] gi|312949007|gb|ADR29834.1| putative deoxyribonuclease YjjV [Escherichia coli O83:H1 str. NRG 857C] gi|315293332|gb|EFU52684.1| hydrolase, TatD family [Escherichia coli MS 153-1] gi|315298357|gb|EFU57612.1| hydrolase, TatD family [Escherichia coli MS 16-3] gi|323950536|gb|EGB46414.1| TatD family protein hydrolase [Escherichia coli H252] gi|331052051|gb|EGI24090.1| putative deoxyribonuclease YjjV [Escherichia coli TA206] Length = 259 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|302038269|ref|YP_003798591.1| deoxyribonuclease, TatD-related [Candidatus Nitrospira defluvii] gi|300606333|emb|CBK42666.1| Uncharacterized deoxyribonuclease, TatD-related [Candidatus Nitrospira defluvii] Length = 259 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H ++ DR +I RA +A V MI I Sbjct: 1 MLIDTHTHLDDARYESDREAMIARAREAGVESMITI 36 >gi|301058387|ref|ZP_07199409.1| hydrolase, TatD family [delta proteobacterium NaphS2] gi|300447510|gb|EFK11253.1| hydrolase, TatD family [delta proteobacterium NaphS2] Length = 251 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%) Query: 6 HCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 HCH + DFD+DR VI RA + + +M++I I Sbjct: 1 HCHLDMKDFDKDREAVIERARREGIGRMVSIGI 33 >gi|309704887|emb|CBJ04240.1| putative deoxyribonuclease [Escherichia coli ETEC H10407] Length = 260 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|293476642|ref|ZP_06665050.1| Mg-dependent DNase [Escherichia coli B088] gi|291321095|gb|EFE60537.1| Mg-dependent DNase [Escherichia coli B088] Length = 260 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|218556913|ref|YP_002389827.1| putative deoxyribonuclease YjjV [Escherichia coli IAI1] gi|218363682|emb|CAR01341.1| putative DNase [Escherichia coli IAI1] gi|323945792|gb|EGB41838.1| TatD family protein hydrolase [Escherichia coli H120] Length = 260 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|191167433|ref|ZP_03029248.1| hydrolase, TatD family [Escherichia coli B7A] gi|190902573|gb|EDV62307.1| hydrolase, TatD family [Escherichia coli B7A] Length = 260 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|157163826|ref|YP_001461144.1| putative deoxyribonuclease YjjV [Escherichia coli HS] gi|157069506|gb|ABV08761.1| hydrolase, TatD family [Escherichia coli HS] Length = 260 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|324007709|gb|EGB76928.1| hydrolase, TatD family [Escherichia coli MS 57-2] Length = 259 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|309781218|ref|ZP_07675955.1| deoxyribonuclease, TatD family [Ralstonia sp. 5_7_47FAA] gi|308920039|gb|EFP65699.1| deoxyribonuclease, TatD family [Ralstonia sp. 5_7_47FAA] Length = 270 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH DFD DR V+ ++ A V ++ A+ Sbjct: 1 MWIDTHCHLDASDFDADRDAVVAQSRAAGVDHIVVPAV 38 >gi|209921844|ref|YP_002295928.1| putative deoxyribonuclease YjjV [Escherichia coli SE11] gi|209915103|dbj|BAG80177.1| conserved hypothetical protein [Escherichia coli SE11] Length = 260 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|293408062|ref|ZP_06651902.1| deoxyribonuclease YjjV [Escherichia coli B354] gi|291472313|gb|EFF14795.1| deoxyribonuclease YjjV [Escherichia coli B354] Length = 259 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|193065641|ref|ZP_03046707.1| hydrolase, TatD family [Escherichia coli E22] gi|194429169|ref|ZP_03061698.1| hydrolase, TatD family [Escherichia coli B171] gi|260847269|ref|YP_003225047.1| putative DNase [Escherichia coli O103:H2 str. 12009] gi|192926714|gb|EDV81342.1| hydrolase, TatD family [Escherichia coli E22] gi|194412784|gb|EDX29077.1| hydrolase, TatD family [Escherichia coli B171] gi|257762416|dbj|BAI33913.1| predicted DNase [Escherichia coli O103:H2 str. 12009] gi|323163265|gb|EFZ49096.1| hypothetical protein ECE128010_0558 [Escherichia coli E128010] Length = 260 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|300923510|ref|ZP_07139546.1| hydrolase, TatD family [Escherichia coli MS 182-1] gi|300420221|gb|EFK03532.1| hydrolase, TatD family [Escherichia coli MS 182-1] Length = 260 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|56551989|ref|YP_162828.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis ZM4] gi|241761928|ref|ZP_04760013.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|56543563|gb|AAV89717.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis ZM4] gi|241373608|gb|EER63180.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 258 Score = 44.9 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI++HCH P E + ++ RA Q+ V M+ +A K Sbjct: 1 MLIDSHCHLNYPGMLEKQPEILQRARQSGVTGMVNVATK 39 >gi|215489690|ref|YP_002332121.1| putative deoxyribonuclease YjjV [Escherichia coli O127:H6 str. E2348/69] gi|215267762|emb|CAS12224.1| predicted DNase [Escherichia coli O127:H6 str. E2348/69] Length = 259 Score = 44.9 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|157155194|ref|YP_001465899.1| putative deoxyribonuclease YjjV [Escherichia coli E24377A] gi|256020009|ref|ZP_05433874.1| putative deoxyribonuclease YjjV [Shigella sp. D9] gi|260871102|ref|YP_003237504.1| putative DNase [Escherichia coli O111:H- str. 11128] gi|300824415|ref|ZP_07104528.1| hydrolase, TatD family [Escherichia coli MS 119-7] gi|309795653|ref|ZP_07690069.1| hydrolase, TatD family [Escherichia coli MS 145-7] gi|331680541|ref|ZP_08381200.1| putative deoxyribonuclease YjjV [Escherichia coli H591] gi|157077224|gb|ABV16932.1| hydrolase, TatD family [Escherichia coli E24377A] gi|257767458|dbj|BAI38953.1| predicted DNase [Escherichia coli O111:H- str. 11128] gi|300523057|gb|EFK44126.1| hydrolase, TatD family [Escherichia coli MS 119-7] gi|308120777|gb|EFO58039.1| hydrolase, TatD family [Escherichia coli MS 145-7] gi|323176282|gb|EFZ61874.1| hypothetical protein ECOK1180_4976 [Escherichia coli 1180] gi|324019803|gb|EGB89022.1| hydrolase, TatD family [Escherichia coli MS 117-3] gi|331072004|gb|EGI43340.1| putative deoxyribonuclease YjjV [Escherichia coli H591] gi|332103507|gb|EGJ06853.1| hydrolase [Shigella sp. D9] Length = 260 Score = 44.9 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|300816003|ref|ZP_07096226.1| hydrolase, TatD family [Escherichia coli MS 107-1] gi|300531210|gb|EFK52272.1| hydrolase, TatD family [Escherichia coli MS 107-1] gi|323181918|gb|EFZ67330.1| hypothetical protein ECOK1357_4789 [Escherichia coli 1357] Length = 260 Score = 44.9 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|237704115|ref|ZP_04534596.1| hydrolase [Escherichia sp. 3_2_53FAA] gi|226902027|gb|EEH88286.1| hydrolase [Escherichia sp. 3_2_53FAA] gi|315284955|gb|EFU44400.1| hydrolase, TatD family [Escherichia coli MS 110-3] gi|323939805|gb|EGB36007.1| TatD family protein hydrolase [Escherichia coli E482] gi|323955334|gb|EGB51106.1| TatD family protein hydrolase [Escherichia coli H263] Length = 260 Score = 44.9 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|170680245|ref|YP_001746833.1| putative deoxyribonuclease YjjV [Escherichia coli SMS-3-5] gi|170517963|gb|ACB16141.1| hydrolase, TatD family [Escherichia coli SMS-3-5] Length = 260 Score = 44.9 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|323190346|gb|EFZ75622.1| hypothetical protein ECRN5871_1501 [Escherichia coli RN587/1] Length = 260 Score = 44.9 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|260752468|ref|YP_003225361.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|258551831|gb|ACV74777.1| hydrolase, TatD family [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 258 Score = 44.9 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI++HCH P E + ++ RA Q+ V M+ +A K Sbjct: 1 MLIDSHCHLNYPGMLEKQPEILQRARQSGVTGMVNVATK 39 >gi|218708056|ref|YP_002415575.1| putative deoxyribonuclease YjjV [Escherichia coli UMN026] gi|293403047|ref|ZP_06647144.1| deoxyribonuclease YjjV [Escherichia coli FVEC1412] gi|298378574|ref|ZP_06988458.1| deoxyribonuclease YjjV [Escherichia coli FVEC1302] gi|300899337|ref|ZP_07117601.1| hydrolase, TatD family [Escherichia coli MS 198-1] gi|331661330|ref|ZP_08362254.1| putative deoxyribonuclease YjjV [Escherichia coli TA143] gi|218435153|emb|CAR16111.1| putative DNase [Escherichia coli UMN026] gi|291429962|gb|EFF02976.1| deoxyribonuclease YjjV [Escherichia coli FVEC1412] gi|298280908|gb|EFI22409.1| deoxyribonuclease YjjV [Escherichia coli FVEC1302] gi|300357061|gb|EFJ72931.1| hydrolase, TatD family [Escherichia coli MS 198-1] gi|331061245|gb|EGI33208.1| putative deoxyribonuclease YjjV [Escherichia coli TA143] Length = 259 Score = 44.9 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|320195329|gb|EFW69957.1| Putative deoxyribonuclease YjjV [Escherichia coli WV_060327] Length = 259 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIIPATEAE 44 >gi|331645075|ref|ZP_08346186.1| putative deoxyribonuclease YjjV [Escherichia coli M605] gi|330909823|gb|EGH38333.1| putative deoxyribonuclease YjjV [Escherichia coli AA86] gi|331045832|gb|EGI17951.1| putative deoxyribonuclease YjjV [Escherichia coli M605] Length = 259 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|193213293|ref|YP_001999246.1| hydrolase, TatD family [Chlorobaculum parvum NCIB 8327] gi|193086770|gb|ACF12046.1| hydrolase, TatD family [Chlorobaculum parvum NCIB 8327] Length = 259 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L + HCH P+FDEDR VI R +A V +I Sbjct: 6 LADIHCHLSFPEFDEDREQVIERLREAGVGLLI 38 >gi|261403900|ref|YP_003240141.1| TatD family hydrolase [Paenibacillus sp. Y412MC10] gi|261280363|gb|ACX62334.1| hydrolase, TatD family [Paenibacillus sp. Y412MC10] Length = 254 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 19/36 (52%), Positives = 22/36 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H P FDEDR I RA +A V +MI I Sbjct: 1 MLFDTHTHMDAPQFDEDREAAIHRALEAGVTRMINI 36 >gi|218698215|ref|YP_002405882.1| putative deoxyribonuclease YjjV [Escherichia coli 55989] gi|218354947|emb|CAV02175.1| putative DNase [Escherichia coli 55989] Length = 260 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|293417851|ref|ZP_06660473.1| Mg-dependent DNase [Escherichia coli B185] gi|291430569|gb|EFF03567.1| Mg-dependent DNase [Escherichia coli B185] Length = 260 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|117919487|ref|YP_868679.1| TatD-related deoxyribonuclease [Shewanella sp. ANA-3] gi|117611819|gb|ABK47273.1| TatD-related deoxyribonuclease [Shewanella sp. ANA-3] Length = 255 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+++TH H +FD DR V+ R QA + +I Sbjct: 1 MMLDTHAHLDFAEFDSDREQVVQRMRQAGIDNLI 34 >gi|167586758|ref|ZP_02379146.1| TatD-related deoxyribonuclease [Burkholderia ubonensis Bu] Length = 262 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAAEFDADRDAVAQAARDAGVARIV 34 >gi|194337098|ref|YP_002018892.1| hydrolase, TatD family [Pelodictyon phaeoclathratiforme BU-1] gi|194309575|gb|ACF44275.1| hydrolase, TatD family [Pelodictyon phaeoclathratiforme BU-1] Length = 257 Score = 44.6 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M ++ HCH P+FDEDR VI R + + +I Sbjct: 1 MFVDIHCHLSFPEFDEDRDEVIKRLKEEGIGLLI 34 >gi|301383493|ref|ZP_07231911.1| hydrolase, TatD family protein [Pseudomonas syringae pv. tomato Max13] gi|302062508|ref|ZP_07254049.1| hydrolase, TatD family protein [Pseudomonas syringae pv. tomato K40] gi|302134185|ref|ZP_07260175.1| hydrolase, TatD family protein [Pseudomonas syringae pv. tomato NCPPB 1108] Length = 267 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +M+ + + Sbjct: 5 LIDTHTHLDFPDFDADRAQVLEHCRSLGVQRMVVLGV 41 >gi|301330273|ref|ZP_07222927.1| hydrolase, TatD family [Escherichia coli MS 78-1] gi|301646895|ref|ZP_07246741.1| hydrolase, TatD family [Escherichia coli MS 146-1] gi|307136577|ref|ZP_07495933.1| putative deoxyribonuclease YjjV [Escherichia coli H736] gi|312966092|ref|ZP_07780318.1| uncharacterized deoxyribonuclease yjjV [Escherichia coli 2362-75] gi|331640420|ref|ZP_08341568.1| putative deoxyribonuclease YjjV [Escherichia coli H736] gi|300843732|gb|EFK71492.1| hydrolase, TatD family [Escherichia coli MS 78-1] gi|301074948|gb|EFK89754.1| hydrolase, TatD family [Escherichia coli MS 146-1] gi|312289335|gb|EFR17229.1| uncharacterized deoxyribonuclease yjjV [Escherichia coli 2362-75] gi|331040166|gb|EGI12373.1| putative deoxyribonuclease YjjV [Escherichia coli H736] Length = 260 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATE 42 >gi|114778161|ref|ZP_01453048.1| TatD-related deoxyribonuclease [Mariprofundus ferrooxydans PV-1] gi|114551579|gb|EAU54133.1| TatD-related deoxyribonuclease [Mariprofundus ferrooxydans PV-1] Length = 258 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 26/42 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 L ++HCH FDEDR V R + V +++A+++++ +T Sbjct: 6 LFDSHCHVDFHHFDEDRDAVFERMREQGVTRVLAVSVELEQT 47 >gi|77457018|ref|YP_346523.1| TatD-like deoxyribonuclease [Pseudomonas fluorescens Pf0-1] gi|77381021|gb|ABA72534.1| putative deoxyribonuclease [Pseudomonas fluorescens Pf0-1] Length = 258 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++H H PDFD DR ++ + V +M+ + + Sbjct: 3 LIDSHTHLDFPDFDADRAALLSESRALGVRRMVVLGV 39 >gi|329889612|ref|ZP_08267955.1| hydrolase, TatD family protein [Brevundimonas diminuta ATCC 11568] gi|328844913|gb|EGF94477.1| hydrolase, TatD family protein [Brevundimonas diminuta ATCC 11568] Length = 261 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 20/40 (50%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P FDEDR VI RA QA V M+ I+ K+ Sbjct: 1 MLIDSHVNLHAPQFDEDREAVIDRARQAGVRLMVEISDKL 40 >gi|167031840|ref|YP_001667071.1| TatD family hydrolase [Pseudomonas putida GB-1] gi|166858328|gb|ABY96735.1| hydrolase, TatD family [Pseudomonas putida GB-1] Length = 258 Score = 44.6 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR ++ A V +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRSRLLANAAARGVERMVVLGV 39 >gi|307729225|ref|YP_003906449.1| TatD-related deoxyribonuclease [Burkholderia sp. CCGE1003] gi|307583760|gb|ADN57158.1| TatD-related deoxyribonuclease [Burkholderia sp. CCGE1003] Length = 262 Score = 44.2 bits (103), Expect = 0.005, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 24/38 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR +V AH+A V +++ AI Sbjct: 1 MWIDTHCHLDASEFDADREHVAAAAHRAGVGRIVIPAI 38 >gi|206580529|ref|YP_002240569.1| hydrolase, TatD family [Klebsiella pneumoniae 342] gi|288937265|ref|YP_003441324.1| TatD-related deoxyribonuclease [Klebsiella variicola At-22] gi|206569587|gb|ACI11363.1| hydrolase, TatD family [Klebsiella pneumoniae 342] gi|288891974|gb|ADC60292.1| TatD-related deoxyribonuclease [Klebsiella variicola At-22] Length = 261 Score = 44.2 bits (103), Expect = 0.005, Method: Composition-based stats. Identities = 19/41 (46%), Positives = 23/41 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F ED + RA QA V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAEDETASLARAAQAGVGQIIVPAISAAR 45 >gi|207722855|ref|YP_002253289.1| deoxyribonuclease protein [Ralstonia solanacearum MolK2] gi|206588039|emb|CAQ18619.1| deoxyribonuclease protein [Ralstonia solanacearum MolK2] Length = 271 Score = 44.2 bits (103), Expect = 0.005, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V+ +A A V ++ AI Sbjct: 1 MWIDTHCHLDAREFDADRDAVVAQARAAGVRHIVVPAI 38 >gi|83748270|ref|ZP_00945296.1| Sec-independent protein translocase protein tatD [Ralstonia solanacearum UW551] gi|207743542|ref|YP_002259934.1| deoxyribonuclease protein [Ralstonia solanacearum IPO1609] gi|83725111|gb|EAP72263.1| Sec-independent protein translocase protein tatD [Ralstonia solanacearum UW551] gi|206594940|emb|CAQ61867.1| deoxyribonuclease protein [Ralstonia solanacearum IPO1609] Length = 271 Score = 44.2 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V+ +A A V ++ AI Sbjct: 1 MWIDTHCHLDAREFDADRDAVVAQARAAGVRHIVVPAI 38 >gi|253998547|ref|YP_003050610.1| TatD-like deoxyribonuclease [Methylovorus sp. SIP3-4] gi|253985226|gb|ACT50083.1| TatD-related deoxyribonuclease [Methylovorus sp. SIP3-4] Length = 255 Score = 44.2 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 27/39 (69%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 ML++THCH +FD+DR ++ +RA A V +++ A++ Sbjct: 1 MLVDTHCHLDASEFDDDRADIALRAQDAGVARIVVPAVE 39 >gi|110808167|ref|YP_691687.1| putative deoxyribonuclease YjjV [Shigella flexneri 5 str. 8401] gi|110617715|gb|ABF06382.1| Mg-dependent DNase [Shigella flexneri 5 str. 8401] Length = 260 Score = 44.2 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|281603715|gb|ADA76699.1| Mg-dependent DNase [Shigella flexneri 2002017] gi|313646266|gb|EFS10728.1| uncharacterized deoxyribonuclease yjjV [Shigella flexneri 2a str. 2457T] Length = 260 Score = 44.2 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|330831156|ref|YP_004394108.1| TatD family Mg-dependent DNase [Aeromonas veronii B565] gi|328806292|gb|AEB51491.1| Mg-dependent DNase, TatD-family [Aeromonas veronii B565] Length = 257 Score = 44.2 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+THCH P FD+DR ++ R V + I AI Sbjct: 3 LIDTHCHLDFPVFDQDREALLARCRALGVTEYIIPAI 39 >gi|251794059|ref|YP_003008790.1| hydrolase, TatD family [Paenibacillus sp. JDR-2] gi|247541685|gb|ACS98703.1| hydrolase, TatD family [Paenibacillus sp. JDR-2] Length = 257 Score = 44.2 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 18/35 (51%), Positives = 19/35 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH H P FD DR VI RA A V MI I Sbjct: 4 LFDTHTHLDSPQFDNDRAEVIERARAAGVDLMINI 38 >gi|189220270|ref|YP_001940910.1| Mg-dependent DNase [Methylacidiphilum infernorum V4] gi|189187128|gb|ACD84313.1| Mg-dependent DNase [Methylacidiphilum infernorum V4] Length = 270 Score = 44.2 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 21/43 (48%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 M I TH H P F +D V+ RA + + K+I I + + Sbjct: 1 MFIETHAHLDFPQFAKDLEEVVERAMASGIDKIITIGTNLKSS 43 >gi|87119542|ref|ZP_01075439.1| hypothetical protein MED121_06375 [Marinomonas sp. MED121] gi|86165018|gb|EAQ66286.1| hypothetical protein MED121_06375 [Marinomonas sp. MED121] Length = 253 Score = 44.2 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 21/38 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I++HCH DF+ D +VI+RA+ + I + Sbjct: 1 MFIDSHCHLDFVDFNSDLDDVIVRAYAEKIQSFIVPST 38 >gi|226941611|ref|YP_002796685.1| Hydrolase, TatD family precursor [Laribacter hongkongensis HLHK9] gi|226716538|gb|ACO75676.1| Hydrolase, TatD family precursor [Laribacter hongkongensis HLHK9] Length = 256 Score = 44.2 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 19/40 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++HCH PD V + V + + I++ V Sbjct: 1 MLIDSHCHLNFPDLAGRIDEVKASMREKGVERAVVISVNV 40 >gi|194434162|ref|ZP_03066430.1| hydrolase, TatD family [Shigella dysenteriae 1012] gi|194417599|gb|EDX33700.1| hydrolase, TatD family [Shigella dysenteriae 1012] gi|320177703|gb|EFW52692.1| Putative deoxyribonuclease YjjV [Shigella boydii ATCC 9905] gi|332083371|gb|EGI88602.1| hypothetical protein SB521682_5254 [Shigella boydii 5216-82] gi|332098347|gb|EGJ03320.1| hypothetical protein SD15574_0019 [Shigella dysenteriae 155-74] Length = 260 Score = 44.2 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|168750985|ref|ZP_02776007.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4113] gi|168756796|ref|ZP_02781803.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4401] gi|168762729|ref|ZP_02787736.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4501] gi|168766659|ref|ZP_02791666.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4486] gi|168776644|ref|ZP_02801651.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4196] gi|168781667|ref|ZP_02806674.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4076] gi|168785021|ref|ZP_02810028.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC869] gi|168797950|ref|ZP_02822957.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC508] gi|195937650|ref|ZP_03083032.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. EC4024] gi|208807002|ref|ZP_03249339.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4206] gi|208812800|ref|ZP_03254129.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4045] gi|208821271|ref|ZP_03261591.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4042] gi|209397271|ref|YP_002273899.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4115] gi|217324568|ref|ZP_03440652.1| hydrolase, TatD family [Escherichia coli O157:H7 str. TW14588] gi|254796374|ref|YP_003081211.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. TW14359] gi|261226735|ref|ZP_05941016.1| predicted DNase [Escherichia coli O157:H7 str. FRIK2000] gi|261255139|ref|ZP_05947672.1| predicted DNase [Escherichia coli O157:H7 str. FRIK966] gi|187768037|gb|EDU31881.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4196] gi|188014919|gb|EDU53041.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4113] gi|189000760|gb|EDU69746.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4076] gi|189356069|gb|EDU74488.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4401] gi|189363936|gb|EDU82355.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4486] gi|189366970|gb|EDU85386.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4501] gi|189375036|gb|EDU93452.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC869] gi|189379565|gb|EDU97981.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC508] gi|208726803|gb|EDZ76404.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4206] gi|208734077|gb|EDZ82764.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4045] gi|208741394|gb|EDZ89076.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4042] gi|209158671|gb|ACI36104.1| hydrolase, TatD family [Escherichia coli O157:H7 str. EC4115] gi|217320789|gb|EEC29213.1| hydrolase, TatD family [Escherichia coli O157:H7 str. TW14588] gi|254595774|gb|ACT75135.1| predicted DNase [Escherichia coli O157:H7 str. TW14359] gi|320190506|gb|EFW65156.1| Putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. EC1212] gi|320638598|gb|EFX08303.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. G5101] gi|326345309|gb|EGD69052.1| Putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. 1125] gi|326346837|gb|EGD70571.1| Putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. 1044] Length = 260 Score = 44.2 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|149708616|ref|XP_001488838.1| PREDICTED: similar to TatD DNase domain containing 3 [Equus caballus] Length = 273 Score = 44.2 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ +A +ANV+ ++ +A Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKKANVMALVVVA 43 >gi|209519980|ref|ZP_03268759.1| TatD-related deoxyribonuclease [Burkholderia sp. H160] gi|209499577|gb|EDZ99653.1| TatD-related deoxyribonuclease [Burkholderia sp. H160] Length = 262 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 21/38 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V A A V +++ AI Sbjct: 1 MWIDTHCHLDASEFDADRDAVAASARHAGVSRIVIPAI 38 >gi|67458628|ref|YP_246252.1| putative deoxyribonuclease, hydrolase [Rickettsia felis URRWXCal2] gi|67004161|gb|AAY61087.1| Putative deoxyribonuclease, hydrolase [Rickettsia felis URRWXCal2] Length = 290 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 23/41 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 MLI++HCH L D D +VI RA + NV M I K+ Sbjct: 1 MLIDSHCHLNLLTKDTDLDSVIQRALENNVQYMQTICTKIE 41 >gi|109899451|ref|YP_662706.1| TatD-related deoxyribonuclease [Pseudoalteromonas atlantica T6c] gi|109701732|gb|ABG41652.1| TatD-related deoxyribonuclease [Pseudoalteromonas atlantica T6c] Length = 256 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 20/40 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +I++HCH P FD DR V+ + Q V ++ + Sbjct: 1 MIDSHCHLDFPAFDLDRDQVLQKCAQLGVNSIVIPGTQAR 40 >gi|313200622|ref|YP_004039280.1| tatd-like deoxyribonuclease [Methylovorus sp. MP688] gi|312439938|gb|ADQ84044.1| TatD-related deoxyribonuclease [Methylovorus sp. MP688] Length = 255 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 27/39 (69%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 ML++THCH +FD+DR ++ +RA A V +++ A++ Sbjct: 1 MLVDTHCHLDASEFDDDRADIAVRAQDAGVARIVVPAVE 39 >gi|307292796|ref|ZP_07572642.1| hydrolase, TatD family [Sphingobium chlorophenolicum L-1] gi|306880862|gb|EFN12078.1| hydrolase, TatD family [Sphingobium chlorophenolicum L-1] Length = 257 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI++HCH ED+ NV+ RA A V M+ IA + Sbjct: 1 MLIDSHCHLNYKGLIEDQKNVLERARSAGVGLMLNIATR 39 >gi|262044976|ref|ZP_06018018.1| TatD family deoxyribonuclease [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|259037703|gb|EEW38932.1| TatD family deoxyribonuclease [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length = 264 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F D + RA QA V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAADEVASLARAAQAGVGRIIVPAISAER 45 >gi|122692429|ref|NP_001073789.1| putative deoxyribonuclease TATDN3 [Bos taurus] gi|166227802|sp|A1A4M4|TATD3_BOVIN RecName: Full=Putative deoxyribonuclease TATDN3 gi|119224018|gb|AAI26725.1| TatD DNase domain containing 3 [Bos taurus] gi|296478867|gb|DAA20982.1| putative deoxyribonuclease TATDN3 [Bos taurus] Length = 273 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ +A +ANV+ ++ +A Sbjct: 8 LVDCHCHLSAPDFDHDLDDVLKKAKEANVMALVVVA 43 >gi|330872485|gb|EGH06634.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. morsprunorum str. M302280PT] Length = 266 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +M+ + + Sbjct: 5 LIDTHTHLDFPDFDADRAQVLEHCRSLGVQRMVVLGV 41 >gi|291285815|ref|YP_003502633.1| Hydrolase, TatD family [Escherichia coli O55:H7 str. CB9615] gi|290765688|gb|ADD59649.1| Hydrolase, TatD family [Escherichia coli O55:H7 str. CB9615] gi|320643887|gb|EFX13007.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H- str. 493-89] gi|320649045|gb|EFX17627.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H- str. H 2687] gi|320654563|gb|EFX22575.1| putative deoxyribonuclease YjjV [Escherichia coli O55:H7 str. 3256-97 TW 07815] gi|320660276|gb|EFX27780.1| putative deoxyribonuclease YjjV [Escherichia coli O55:H7 str. USDA 5905] gi|320665371|gb|EFX32455.1| putative deoxyribonuclease YjjV [Escherichia coli O157:H7 str. LSU-61] Length = 260 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|260590833|ref|ZP_05856291.1| deoxyribonuclease, TatD family [Prevotella veroralis F0319] gi|260537184|gb|EEX19801.1| deoxyribonuclease, TatD family [Prevotella veroralis F0319] Length = 283 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 25/41 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M+I+TH H + DF ED VIMRA +A V K+ ++ + Sbjct: 1 MIIDTHAHLDVEDFSEDLSEVIMRAKEAGVGKIFLPSVDLK 41 >gi|116751044|ref|YP_847731.1| TatD family hydrolase [Syntrophobacter fumaroxidans MPOB] gi|116700108|gb|ABK19296.1| hydrolase, TatD family [Syntrophobacter fumaroxidans MPOB] Length = 264 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 26/40 (65%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+TH H P+F +D V+ RA +A+V K+I I I + Sbjct: 1 MLIDTHAHLDFPEFAQDLPAVLERAAKADVRKIITIGISL 40 >gi|330006942|ref|ZP_08305811.1| hydrolase, TatD family [Klebsiella sp. MS 92-3] gi|328535629|gb|EGF62081.1| hydrolase, TatD family [Klebsiella sp. MS 92-3] Length = 264 Score = 43.8 bits (102), Expect = 0.007, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F D + RA QA V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAADEVASLARAAQAGVGRIIVPAISAER 45 >gi|194439278|ref|ZP_03071357.1| hydrolase, TatD family [Escherichia coli 101-1] gi|194421760|gb|EDX37768.1| hydrolase, TatD family [Escherichia coli 101-1] gi|323970827|gb|EGB66079.1| TatD family protein hydrolase [Escherichia coli TA007] Length = 259 Score = 43.8 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|300691901|ref|YP_003752896.1| DNAse, hydrolase with metallo-dependent hydrolase domain [Ralstonia solanacearum PSI07] gi|299078961|emb|CBJ51621.1| putative DNAse, hydrolase with metallo-dependent hydrolase domain [Ralstonia solanacearum PSI07] Length = 271 Score = 43.8 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR VI +A A V ++ AI Sbjct: 1 MWIDTHCHLDAREFDADRDAVIEQARAAGVHHIVVPAI 38 >gi|91776266|ref|YP_546022.1| TatD-related deoxyribonuclease [Methylobacillus flagellatus KT] gi|91710253|gb|ABE50181.1| TatD-related deoxyribonuclease [Methylobacillus flagellatus KT] Length = 268 Score = 43.8 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 22/37 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+THCH P+FD DR V A QA V ++ A+ Sbjct: 4 LIDTHCHLDAPEFDHDRDEVAQAAWQAGVGIIVVPAV 40 >gi|171321905|ref|ZP_02910798.1| TatD-related deoxyribonuclease [Burkholderia ambifaria MEX-5] gi|171092802|gb|EDT38072.1| TatD-related deoxyribonuclease [Burkholderia ambifaria MEX-5] Length = 262 Score = 43.8 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAGEFDADRDAVAETARAAGVSRIV 34 >gi|331650864|ref|ZP_08351892.1| putative deoxyribonuclease YjjV [Escherichia coli M718] gi|331051318|gb|EGI23367.1| putative deoxyribonuclease YjjV [Escherichia coli M718] Length = 260 Score = 43.8 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFIGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|331019106|gb|EGH99162.1| hydrolase, TatD family protein [Pseudomonas syringae pv. lachrymans str. M302278PT] Length = 261 Score = 43.8 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRAQVLKHCRSLGVQRMVVLGV 39 >gi|330508316|ref|YP_004384744.1| deoxyribonuclease [Methanosaeta concilii GP-6] gi|328929124|gb|AEB68926.1| Uncharacterized deoxyribonuclease [Methanosaeta concilii GP-6] Length = 268 Score = 43.8 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 21/32 (65%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I++HCH F++DR V+ A +A V++MI Sbjct: 21 IDSHCHLDFKHFNKDREAVMENARKAGVVRMI 52 >gi|238892966|ref|YP_002917700.1| putative hydrolase [Klebsiella pneumoniae NTUH-K2044] gi|238545282|dbj|BAH61633.1| putative hydrolase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] Length = 264 Score = 43.8 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F D + RA QA V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAADEVASLARAAQAGVGRIIVPAISAER 45 >gi|317120933|ref|YP_004100936.1| hydrolase, TatD family [Thermaerobacter marianensis DSM 12885] gi|315590913|gb|ADU50209.1| hydrolase, TatD family [Thermaerobacter marianensis DSM 12885] Length = 290 Score = 43.4 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +L++THCH P+FD DR V+ A A V MI I + V Sbjct: 19 VLVDTHCHLDFPEFDPDRDQVVEAARAAGVAAMITIGVDV 58 >gi|78186369|ref|YP_374412.1| TatD-related deoxyribonuclease [Chlorobium luteolum DSM 273] gi|78166271|gb|ABB23369.1| Sec-independent protein translocase TatD [Chlorobium luteolum DSM 273] Length = 256 Score = 43.4 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ML + HCH P+FD DR VI R A V +I Sbjct: 1 MLADAHCHLSFPEFDPDRQEVIQRMQAAGVTLLI 34 >gi|170723563|ref|YP_001751251.1| TatD-related deoxyribonuclease [Pseudomonas putida W619] gi|169761566|gb|ACA74882.1| TatD-related deoxyribonuclease [Pseudomonas putida W619] Length = 258 Score = 43.4 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR ++ A V +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRTRLMANAAGRGVERMVVLGV 39 >gi|294496592|ref|YP_003543085.1| hydrolase, TatD family [Methanohalophilus mahii DSM 5219] gi|292667591|gb|ADE37440.1| hydrolase, TatD family [Methanohalophilus mahii DSM 5219] Length = 272 Score = 43.4 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 23/40 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I++HCH F++DR VI+RA +A +MI I + Sbjct: 25 FIDSHCHLDFSKFNKDREEVILRAKEAGACEMINSGIDLK 64 >gi|268317732|ref|YP_003291451.1| hydrolase, TatD family [Rhodothermus marinus DSM 4252] gi|262335266|gb|ACY49063.1| hydrolase, TatD family [Rhodothermus marinus DSM 4252] Length = 263 Score = 43.4 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 20/39 (51%), Positives = 25/39 (64%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 LI+TH H L FDEDR V+ RA +A V+ M+ AI V Sbjct: 4 LIDTHVHLYLEAFDEDRDEVVARAREAGVVAMVLPAIDV 42 >gi|172061067|ref|YP_001808719.1| TatD-related deoxyribonuclease [Burkholderia ambifaria MC40-6] gi|171993584|gb|ACB64503.1| TatD-related deoxyribonuclease [Burkholderia ambifaria MC40-6] Length = 262 Score = 43.4 bits (101), Expect = 0.009, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAGEFDADRDAVAEAARTAGVSRIV 34 >gi|299067170|emb|CBJ38366.1| putative DNAse, hydrolase with metallo-dependent hydrolase domain [Ralstonia solanacearum CMR15] Length = 271 Score = 43.4 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR VI +A A V ++ AI Sbjct: 1 MWIDTHCHLDAREFDADRDTVIEQARAAGVRHIVVPAI 38 >gi|223939452|ref|ZP_03631329.1| hydrolase, TatD family [bacterium Ellin514] gi|223891837|gb|EEF58321.1| hydrolase, TatD family [bacterium Ellin514] Length = 277 Score = 43.4 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 22/40 (55%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 +TH H PD+ +D VI R+ A + K+I+I + + Sbjct: 10 DTHAHLDYPDYAQDLQQVIARSEAAGITKIISIGTDLESS 49 >gi|312958917|ref|ZP_07773436.1| TatD-like deoxyribonuclease [Pseudomonas fluorescens WH6] gi|311286687|gb|EFQ65249.1| TatD-like deoxyribonuclease [Pseudomonas fluorescens WH6] Length = 241 Score = 43.4 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ + + V +M+ + + Sbjct: 3 LIDTHTHLDFADFDTDRREVLAHSRELGVRRMVVLGV 39 >gi|239948425|ref|ZP_04700178.1| hydrolase, TatD family [Rickettsia endosymbiont of Ixodes scapularis] gi|239922701|gb|EER22725.1| hydrolase, TatD family [Rickettsia endosymbiont of Ixodes scapularis] Length = 266 Score = 43.4 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 23/41 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 MLI++HCH L D D +VI RA + NV M I K+ Sbjct: 1 MLIDSHCHLNLLTKDTDLDSVIQRALENNVQYMQTICTKIE 41 >gi|197105066|ref|YP_002130443.1| urease/pyrimidinase family protein [Phenylobacterium zucineum HLK1] gi|196478486|gb|ACG78014.1| urease/pyrimidinase family protein [Phenylobacterium zucineum HLK1] Length = 258 Score = 43.4 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + P FD+DR VI RA A V M+ I +V Sbjct: 1 MLIDSHVNLHAPQFDDDREAVISRALAAGVRLMVNICDRV 40 >gi|241563443|ref|XP_002401706.1| conserved hypothetical protein [Ixodes scapularis] gi|215501898|gb|EEC11392.1| conserved hypothetical protein [Ixodes scapularis] Length = 267 Score = 43.4 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 23/41 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 MLI++HCH L D D +VI RA + NV M I K+ Sbjct: 2 MLIDSHCHLNLLTKDTDLDSVIQRALENNVQYMQTICTKIE 42 >gi|78066887|ref|YP_369656.1| TatD-related deoxyribonuclease [Burkholderia sp. 383] gi|77967632|gb|ABB09012.1| TatD-related deoxyribonuclease [Burkholderia sp. 383] Length = 262 Score = 43.4 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAAEFDADRDAVAHAARSAGVSRIV 34 >gi|304405867|ref|ZP_07387525.1| hydrolase, TatD family [Paenibacillus curdlanolyticus YK9] gi|304345110|gb|EFM10946.1| hydrolase, TatD family [Paenibacillus curdlanolyticus YK9] Length = 258 Score = 43.4 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 19/35 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+TH H FD DR I RA +A V MI I Sbjct: 4 LIDTHTHMDNHKFDNDRDEAIARAREAGVELMINI 38 >gi|167581345|ref|ZP_02374219.1| hydrolase, TatD family protein [Burkholderia thailandensis TXDOH] Length = 262 Score = 43.4 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M ++THCH P+FD DR V A A V +++ Sbjct: 1 MWVDTHCHLDAPEFDADREVVADAARAAGVSRIV 34 >gi|104780152|ref|YP_606650.1| TatD family deoxyribonuclease [Pseudomonas entomophila L48] gi|95109139|emb|CAK13836.1| putative deoxyribonuclease, TatD family (metal-dependent) [Pseudomonas entomophila L48] Length = 258 Score = 43.4 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR ++ A V +++ + + Sbjct: 3 LIDTHTHLDFPDFDADREPLLANAAARGVERVVVLGV 39 >gi|152986541|ref|YP_001346965.1| hypothetical protein PSPA7_1581 [Pseudomonas aeruginosa PA7] gi|150961699|gb|ABR83724.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7] Length = 259 Score = 43.4 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L++TH H PDFD DR ++ R+ V + + + + Sbjct: 3 LVDTHNHLDFPDFDADRAALLQRSRALGVERQVVLGV 39 >gi|313108914|ref|ZP_07794892.1| putative deoxyribonuclease, TatD family [Pseudomonas aeruginosa 39016] gi|310881394|gb|EFQ39988.1| putative deoxyribonuclease, TatD family [Pseudomonas aeruginosa 39016] Length = 259 Score = 43.4 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L++TH H PDFD DR ++ R+ V + + + + Sbjct: 3 LVDTHNHLDFPDFDADRAALLQRSRALGVERQVVLGV 39 >gi|301763633|ref|XP_002917240.1| PREDICTED: putative deoxyribonuclease TATDN3-like, partial [Ailuropoda melanoleuca] Length = 283 Score = 43.4 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 24/35 (68%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ++ HCH PDFD D +V+ +A +ANV+ ++ +A Sbjct: 11 VDCHCHLSAPDFDSDLDDVLEKAKKANVMALVVVA 45 >gi|70734349|ref|YP_257989.1| TatD family hydrolase [Pseudomonas fluorescens Pf-5] gi|68348648|gb|AAY96254.1| hydrolase, TatD family [Pseudomonas fluorescens Pf-5] Length = 263 Score = 43.4 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++H H DFD DR ++ + V +M+ + + Sbjct: 3 LIDSHTHLDFADFDADRGALLADSRALGVSRMVVLGV 39 >gi|83721298|ref|YP_442419.1| TatD family hydrolase [Burkholderia thailandensis E264] gi|167619425|ref|ZP_02388056.1| hydrolase, TatD family protein [Burkholderia thailandensis Bt4] gi|257138622|ref|ZP_05586884.1| TatD family hydrolase [Burkholderia thailandensis E264] gi|83655123|gb|ABC39186.1| hydrolase, TatD family [Burkholderia thailandensis E264] Length = 262 Score = 43.4 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M ++THCH P+FD DR V A A V +++ Sbjct: 1 MWVDTHCHLDAPEFDADREVVADAARAAGVSRIV 34 >gi|17545838|ref|NP_519240.1| deoxyribonuclease protein [Ralstonia solanacearum GMI1000] gi|17428132|emb|CAD14821.1| probable deoxyribonuclease protein [Ralstonia solanacearum GMI1000] Length = 271 Score = 43.4 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR VI +A A V ++ AI Sbjct: 1 MWIDTHCHLDAREFDADRDAVIEQARVAGVRHIVVPAI 38 >gi|254540122|ref|NP_081171.1| putative deoxyribonuclease TATDN3 isoform 1 [Mus musculus] Length = 294 Score = 43.4 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 40 >gi|107103076|ref|ZP_01366994.1| hypothetical protein PaerPA_01004145 [Pseudomonas aeruginosa PACS2] Length = 259 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L++TH H PDFD DR ++ R+ V + + + + Sbjct: 3 LVDTHNHLDFPDFDADRAALLQRSRALGVERQVVLGV 39 >gi|220917740|ref|YP_002493044.1| hydrolase, TatD family [Anaeromyxobacter dehalogenans 2CP-1] gi|219955594|gb|ACL65978.1| hydrolase, TatD family [Anaeromyxobacter dehalogenans 2CP-1] Length = 258 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 22/36 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI++H H L D+ D VI RA +A + +++ + Sbjct: 1 MLIDSHAHLDLDDYRGDLDAVIARAREAGLARVVCV 36 >gi|145300526|ref|YP_001143367.1| TatD family Mg-dependent DNase [Aeromonas salmonicida subsp. salmonicida A449] gi|142853298|gb|ABO91619.1| Mg-dependent DNase, TatD-family [Aeromonas salmonicida subsp. salmonicida A449] Length = 262 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+THCH P FD DR ++ Q V + I Sbjct: 3 LIDTHCHLDFPVFDPDRTALLAECRQLGVGEYI 35 >gi|123790766|sp|Q3U1C6|TATD3_MOUSE RecName: Full=Putative deoxyribonuclease TATDN3 gi|74217670|dbj|BAE33572.1| unnamed protein product [Mus musculus] gi|148681063|gb|EDL13010.1| mCG14106, isoform CRA_d [Mus musculus] Length = 294 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 40 >gi|189500705|ref|YP_001960175.1| hydrolase, TatD family [Chlorobium phaeobacteroides BS1] gi|189496146|gb|ACE04694.1| hydrolase, TatD family [Chlorobium phaeobacteroides BS1] Length = 263 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 22/43 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 M ++ HCH P+FDEDR VI R + N+ +I + Sbjct: 1 MFVDVHCHLSFPEFDEDRPEVIRRLREQNISLLIDPGTNTETS 43 >gi|116622454|ref|YP_824610.1| TatD family hydrolase [Candidatus Solibacter usitatus Ellin6076] gi|116225616|gb|ABJ84325.1| hydrolase, TatD family [Candidatus Solibacter usitatus Ellin6076] Length = 257 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L+++HCH FD DR V+ RA A V M+AI Sbjct: 3 LVDSHCHLDDEKFDADREQVMERALAAGVETMMAIGT 39 >gi|294665661|ref|ZP_06730937.1| TatD related DNase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] gi|292604556|gb|EFF47931.1| TatD related DNase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] Length = 255 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH +FD DR VI RA A V++ + AI Sbjct: 3 LIDSHCHLDAGEFDHDRATVIARAQAAGVVQQVVPAI 39 >gi|260803116|ref|XP_002596437.1| hypothetical protein BRAFLDRAFT_77148 [Branchiostoma floridae] gi|229281693|gb|EEN52449.1| hypothetical protein BRAFLDRAFT_77148 [Branchiostoma floridae] Length = 264 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I+ HCH +FDED VI RA +A + ++A+A Sbjct: 5 IDCHCHLSAEEFDEDLDEVITRAKEAGIGAIVAVA 39 >gi|152973299|ref|YP_001338445.1| putative hydrolase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|150958148|gb|ABR80178.1| putative hydrolase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 264 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F D + RA QA V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAADEVASLARAAQAGVERIIVPAISAER 45 >gi|148681060|gb|EDL13007.1| mCG14106, isoform CRA_a [Mus musculus] Length = 293 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 40 >gi|296387933|ref|ZP_06877408.1| hypothetical protein PaerPAb_07254 [Pseudomonas aeruginosa PAb1] Length = 259 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L++TH H PDFD DR ++ R+ V + + + + Sbjct: 3 LVDTHNHLDFPDFDADRAALLQRSRALGVERQVVLGV 39 >gi|197122948|ref|YP_002134899.1| hydrolase, TatD family [Anaeromyxobacter sp. K] gi|196172797|gb|ACG73770.1| hydrolase, TatD family [Anaeromyxobacter sp. K] Length = 258 Score = 43.0 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 22/36 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI++H H L D+ D VI RA +A + +++ + Sbjct: 1 MLIDSHAHLDLDDYRGDLDAVIARAREAGLARVVCV 36 >gi|84623062|ref|YP_450434.1| hypothetical protein XOO_1405 [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|84367002|dbj|BAE68160.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF 311018] Length = 255 Score = 43.0 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI++HCH +FD DR VI RA A V++ + Sbjct: 3 LIDSHCHLDAGEFDHDRATVIARAQAAGVIQQV 35 >gi|114046605|ref|YP_737155.1| TatD-related deoxyribonuclease [Shewanella sp. MR-7] gi|113888047|gb|ABI42098.1| TatD-related deoxyribonuclease [Shewanella sp. MR-7] Length = 255 Score = 43.0 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+++TH H +FD DR V+ R QA + +I Sbjct: 1 MMLDTHAHLDFVEFDSDREQVVQRMRQAGIDNLI 34 >gi|170768627|ref|ZP_02903080.1| hydrolase, TatD family [Escherichia albertii TW07627] gi|170122731|gb|EDS91662.1| hydrolase, TatD family [Escherichia albertii TW07627] Length = 260 Score = 43.0 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFCGDETASLQRAAQAGVGKIIVPATE 42 >gi|288802128|ref|ZP_06407569.1| hydrolase [Prevotella melaninogenica D18] gi|288335563|gb|EFC73997.1| hydrolase [Prevotella melaninogenica D18] Length = 270 Score = 43.0 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 25/41 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M+I+TH H + DF +D VI RAH+A V K+ AI + Sbjct: 1 MIIDTHAHLDVEDFADDLPEVISRAHEAGVGKIFLPAIDLK 41 >gi|57234288|ref|YP_181659.1| TatD family hydrolase [Dehalococcoides ethenogenes 195] gi|57224736|gb|AAW39793.1| hydrolase, TatD family [Dehalococcoides ethenogenes 195] Length = 264 Score = 43.0 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 22/38 (57%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++TH H +P+FD DR ++ RA + V +I I + Sbjct: 7 VDTHSHLDMPEFDADRQEMLKRAFENGVKTIITTGIDI 44 >gi|38174687|gb|AAH61248.1| Tatdn3 protein [Mus musculus] gi|148681061|gb|EDL13008.1| mCG14106, isoform CRA_b [Mus musculus] Length = 247 Score = 43.0 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 20 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 55 >gi|290512669|ref|ZP_06552035.1| Mg-dependent DNase [Klebsiella sp. 1_1_55] gi|289775010|gb|EFD83012.1| Mg-dependent DNase [Klebsiella sp. 1_1_55] Length = 261 Score = 43.0 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F ED + RA Q V ++I AI R Sbjct: 5 FIDTHCHFDFPPFAEDETASLARAAQVGVGQIIVPAISAAR 45 >gi|188575648|ref|YP_001912577.1| putative deoxyribonuclease YjjV [Xanthomonas oryzae pv. oryzae PXO99A] gi|188520100|gb|ACD58045.1| putative deoxyribonuclease YjjV [Xanthomonas oryzae pv. oryzae PXO99A] Length = 255 Score = 43.0 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI++HCH +FD DR VI RA A V++ + Sbjct: 3 LIDSHCHLDAGEFDHDRATVIARAQAAGVIQQV 35 >gi|113969378|ref|YP_733171.1| TatD-related deoxyribonuclease [Shewanella sp. MR-4] gi|113884062|gb|ABI38114.1| TatD-related deoxyribonuclease [Shewanella sp. MR-4] Length = 255 Score = 43.0 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+++TH H +FD DR V+ R QA + +I Sbjct: 1 MMLDTHAHLDFVEFDSDREQVVQRMRQAGIDNLI 34 >gi|257460368|ref|ZP_05625469.1| Mg-dependent DNase [Campylobacter gracilis RM3268] gi|257441699|gb|EEV16841.1| Mg-dependent DNase [Campylobacter gracilis RM3268] Length = 265 Score = 43.0 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+THCH FD D VI RA A V +I Sbjct: 1 MIIDTHCHLDDASFDADLDAVIERATIAGVRSII 34 >gi|300704511|ref|YP_003746114.1| dnase, hydrolase with metallo-dependent hydrolase domain [Ralstonia solanacearum CFBP2957] gi|299072175|emb|CBJ43507.1| putative DNAse, hydrolase with metallo-dependent hydrolase domain [Ralstonia solanacearum CFBP2957] Length = 271 Score = 43.0 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V+ +A A V ++ AI Sbjct: 1 MWIDTHCHLDAREFDADRDAVVAQAWAAGVRHIVVPAI 38 >gi|73960880|ref|XP_547404.2| PREDICTED: similar to B0432.8 [Canis familiaris] Length = 339 Score = 43.0 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 24/35 (68%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ++ HCH PDFD D +V+ +A +ANV+ ++ +A Sbjct: 9 VDCHCHLSAPDFDSDLDDVLEKAKKANVMALVMVA 43 >gi|296284129|ref|ZP_06862127.1| Mg-dependent DNase [Citromicrobium bathyomarinum JL354] Length = 264 Score = 43.0 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI++HCH +D+ V+ RA +A V + I+ K Sbjct: 1 MLIDSHCHLEYEGLVDDQDAVLSRAREAGVQGFLNISTK 39 >gi|187478026|ref|YP_786050.1| deoxyribonuclease [Bordetella avium 197N] gi|115422612|emb|CAJ49137.1| putative deoxyribonuclease [Bordetella avium 197N] Length = 266 Score = 43.0 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI+THCH +FD DR + A +A V ++ Sbjct: 1 MLIDTHCHLDAAEFDADRRALWQAAREAGVGAIV 34 >gi|166712676|ref|ZP_02243883.1| hypothetical protein Xoryp_14785 [Xanthomonas oryzae pv. oryzicola BLS256] Length = 255 Score = 42.6 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI++HCH +FD DR VI RA A V++ + Sbjct: 3 LIDSHCHLDAGEFDHDRATVIARAQAAGVIQQV 35 >gi|58581137|ref|YP_200153.1| hypothetical protein XOO1514 [Xanthomonas oryzae pv. oryzae KACC10331] gi|58425731|gb|AAW74768.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae KACC10331] Length = 255 Score = 42.6 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI++HCH +FD DR VI RA A V++ + Sbjct: 3 LIDSHCHLDAGEFDHDRATVIARAQAAGVIQQV 35 >gi|319779406|ref|YP_004130319.1| Putative deoxyribonuclease YjjV [Taylorella equigenitalis MCE9] gi|317109430|gb|ADU92176.1| Putative deoxyribonuclease YjjV [Taylorella equigenitalis MCE9] Length = 267 Score = 42.6 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 20/38 (52%), Positives = 23/38 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH DF +D NVI RA VLK+I AI Sbjct: 1 MFIDTHCHLDALDFKQDLQNVISRAQDNGVLKIIIPAI 38 >gi|269837325|ref|YP_003319553.1| hydrolase, TatD family [Sphaerobacter thermophilus DSM 20745] gi|269786588|gb|ACZ38731.1| hydrolase, TatD family [Sphaerobacter thermophilus DSM 20745] Length = 261 Score = 42.6 bits (99), Expect = 0.016, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 24/41 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 L++THCH L FDEDR V+ RA + V +++ + R Sbjct: 3 LVDTHCHLDLEAFDEDRAQVLARARASGVERILVVGFAPER 43 >gi|253996923|ref|YP_003048987.1| TatD-like deoxyribonuclease [Methylotenera mobilis JLW8] gi|253983602|gb|ACT48460.1| TatD-related deoxyribonuclease [Methylotenera mobilis JLW8] Length = 270 Score = 42.6 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 23/38 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 MLI+THCH +FD DR +++ A + V ++ A+ Sbjct: 1 MLIDTHCHLDAAEFDADRDHIVCAAFENGVSGIVVPAV 38 >gi|254251979|ref|ZP_04945297.1| hypothetical protein BDAG_01187 [Burkholderia dolosa AUO158] gi|124894588|gb|EAY68468.1| hypothetical protein BDAG_01187 [Burkholderia dolosa AUO158] Length = 262 Score = 42.6 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAAEFDADRDAVAQSACAAGVSRIV 34 >gi|160876475|ref|YP_001555791.1| TatD-like deoxyribonuclease [Shewanella baltica OS195] gi|160861997|gb|ABX50531.1| TatD-related deoxyribonuclease [Shewanella baltica OS195] gi|315268665|gb|ADT95518.1| TatD-related deoxyribonuclease [Shewanella baltica OS678] Length = 254 Score = 42.6 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ R H V +I Sbjct: 1 MIDTHAHLDFVEFDIDRDAVVQRMHSVGVNNLI 33 >gi|194366418|ref|YP_002029028.1| hydrolase, TatD family [Stenotrophomonas maltophilia R551-3] gi|194349222|gb|ACF52345.1| hydrolase, TatD family [Stenotrophomonas maltophilia R551-3] Length = 256 Score = 42.6 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 23/38 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 +L+++HCH +FD DR V+ RA A V + + A+ Sbjct: 3 LLVDSHCHLDASEFDRDRAAVVERAQAAGVHQQVVPAV 40 >gi|192359527|ref|YP_001981677.1| Mg-dependent DNase [Cellvibrio japonicus Ueda107] gi|190685692|gb|ACE83370.1| Mg-dependent DNase [Cellvibrio japonicus Ueda107] Length = 267 Score = 42.6 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ML +THCH +FD DR V + V+K++ Sbjct: 1 MLFDTHCHLDFDEFDGDRAAVWQSCRDSGVVKLM 34 >gi|85374073|ref|YP_458135.1| Mg-dependent DNase [Erythrobacter litoralis HTCC2594] gi|84787156|gb|ABC63338.1| Mg-dependent DNase [Erythrobacter litoralis HTCC2594] Length = 258 Score = 42.6 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 22/39 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 ML+++HCH ED+ V+ RA A V M+ I+ K Sbjct: 1 MLVDSHCHLQYKGLVEDQQAVLERARAAGVQGMLNISTK 39 >gi|33592246|ref|NP_879890.1| putative deoxyribonuclease [Bordetella pertussis Tohama I] gi|33596667|ref|NP_884310.1| putative deoxyribonuclease [Bordetella parapertussis 12822] gi|33571891|emb|CAE41407.1| putative deoxyribonuclease [Bordetella pertussis Tohama I] gi|33573368|emb|CAE37352.1| putative deoxyribonuclease [Bordetella parapertussis] Length = 275 Score = 42.6 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI+THCH +FD DR V A +A V ++ Sbjct: 1 MLIDTHCHLDAAEFDADRMAVARAAREAGVQAIV 34 >gi|260893944|ref|YP_003240041.1| hydrolase, TatD family [Ammonifex degensii KC4] gi|260866085|gb|ACX53191.1| hydrolase, TatD family [Ammonifex degensii KC4] Length = 261 Score = 42.6 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 20/35 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+THCH P + D V+ RA QA V MI + Sbjct: 3 LIDTHCHLNDPRLEADLPEVLARARQAGVKVMIVV 37 >gi|126175430|ref|YP_001051579.1| TatD-related deoxyribonuclease [Shewanella baltica OS155] gi|125998635|gb|ABN62710.1| TatD-related deoxyribonuclease [Shewanella baltica OS155] Length = 254 Score = 42.6 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ R V +I Sbjct: 1 MIDTHAHLDFAEFDVDRDAVVQRMRSVGVNNLI 33 >gi|296101157|ref|YP_003611303.1| TatD-related deoxyribonuclease [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|295055616|gb|ADF60354.1| TatD-related deoxyribonuclease [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 260 Score = 42.6 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 19/41 (46%), Positives = 23/41 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++THCHF P F D I RA QA + MI AI+V R Sbjct: 5 FVDTHCHFDFPPFTGDETQSIERAAQAGIHAMIVPAIEVDR 45 >gi|161504888|ref|YP_001572000.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|160866235|gb|ABX22858.1| hypothetical protein SARI_03014 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] Length = 257 Score = 42.6 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDELASIQRAREAGVEKIIVPATE 42 >gi|254540124|ref|NP_001156893.1| putative deoxyribonuclease TATDN3 isoform 2 [Mus musculus] Length = 232 Score = 42.6 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 40 >gi|221198417|ref|ZP_03571463.1| putative deoxyribonuclease yjjV [Burkholderia multivorans CGD2M] gi|221208906|ref|ZP_03581903.1| putative deoxyribonuclease yjjV [Burkholderia multivorans CGD2] gi|221171189|gb|EEE03639.1| putative deoxyribonuclease yjjV [Burkholderia multivorans CGD2] gi|221182349|gb|EEE14750.1| putative deoxyribonuclease yjjV [Burkholderia multivorans CGD2M] Length = 262 Score = 42.6 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAAEFDGDRDAVAHAARTAGVSRIV 34 >gi|221214763|ref|ZP_03587732.1| putative deoxyribonuclease yjjV [Burkholderia multivorans CGD1] gi|221165302|gb|EED97779.1| putative deoxyribonuclease yjjV [Burkholderia multivorans CGD1] Length = 262 Score = 42.6 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAAEFDGDRDAVAHAARTAGVSRIV 34 >gi|119356541|ref|YP_911185.1| TatD family hydrolase [Chlorobium phaeobacteroides DSM 266] gi|119353890|gb|ABL64761.1| hydrolase, TatD family [Chlorobium phaeobacteroides DSM 266] Length = 255 Score = 42.3 bits (98), Expect = 0.020, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+ HCH P+FD+DR VI R + + +I Sbjct: 1 MFIDAHCHLSFPEFDQDRSEVIERLNAGGISLLI 34 >gi|145219352|ref|YP_001130061.1| TatD family hydrolase [Prosthecochloris vibrioformis DSM 265] gi|145205516|gb|ABP36559.1| hydrolase, TatD family [Chlorobium phaeovibrioides DSM 265] Length = 257 Score = 42.3 bits (98), Expect = 0.020, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M + HCH P FDEDR VI R +A V +I Sbjct: 1 MFADAHCHLSFPAFDEDRPAVIERMKEAGVTLLI 34 >gi|167042814|gb|ABZ07532.1| putative TatD related DNase [uncultured marine microorganism HF4000_ANIW137I15] Length = 482 Score = 42.3 bits (98), Expect = 0.020, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 22/38 (57%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +++HCH FD+DR V+ RA QA V M+ + + Sbjct: 25 VDSHCHLEDSQFDDDRPGVLERARQAGVRFMMTLGSDI 62 >gi|270308205|ref|YP_003330263.1| hydrolase, TatD family, Mg-dependent DNase [Dehalococcoides sp. VS] gi|270154097|gb|ACZ61935.1| hydrolase, TatD family, Mg-dependent DNase [Dehalococcoides sp. VS] Length = 264 Score = 42.3 bits (98), Expect = 0.020, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 21/38 (55%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 I+TH H +P+FD DR + RA + V +I I + Sbjct: 7 IDTHAHLDMPEFDTDRQEIFRRAFENGVKTIITTGIDI 44 >gi|33601283|ref|NP_888843.1| putative deoxyribonuclease [Bordetella bronchiseptica RB50] gi|33575718|emb|CAE32796.1| putative deoxyribonuclease [Bordetella bronchiseptica RB50] Length = 275 Score = 42.3 bits (98), Expect = 0.020, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI+THCH +FD DR V A +A V ++ Sbjct: 1 MLIDTHCHLDAAEFDADRMAVARAAREAGVQAIV 34 >gi|308188083|ref|YP_003932214.1| deoxyribonuclease [Pantoea vagans C9-1] gi|308058593|gb|ADO10765.1| putative deoxyribonuclease [Pantoea vagans C9-1] Length = 265 Score = 42.3 bits (98), Expect = 0.021, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 23/41 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F+ D + RA +A V K+I AI R Sbjct: 3 FIDTHCHFDFPPFEGDVAASLTRAAEAGVEKIIIPAIDASR 43 >gi|302383103|ref|YP_003818926.1| hydrolase, TatD family [Brevundimonas subvibrioides ATCC 15264] gi|302193731|gb|ADL01303.1| hydrolase, TatD family [Brevundimonas subvibrioides ATCC 15264] Length = 260 Score = 42.3 bits (98), Expect = 0.021, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 MLI++H + FDEDR VI RA A V M+ I+ Sbjct: 1 MLIDSHVNLHAAQFDEDRDAVIDRARAAGVGLMVEIS 37 >gi|161524333|ref|YP_001579345.1| TatD-related deoxyribonuclease [Burkholderia multivorans ATCC 17616] gi|189350911|ref|YP_001946539.1| Mg-dependent DNase [Burkholderia multivorans ATCC 17616] gi|160341762|gb|ABX14848.1| TatD-related deoxyribonuclease [Burkholderia multivorans ATCC 17616] gi|189334933|dbj|BAG44003.1| Mg-dependent DNase [Burkholderia multivorans ATCC 17616] Length = 262 Score = 42.3 bits (98), Expect = 0.021, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAAEFDGDRDAVAHAARTAGVSRIV 34 >gi|254784957|ref|YP_003072385.1| deoxyribonuclease YjjV [Teredinibacter turnerae T7901] gi|237686314|gb|ACR13578.1| putative deoxyribonuclease YjjV [Teredinibacter turnerae T7901] Length = 256 Score = 42.3 bits (98), Expect = 0.022, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ML+++HCH FD DR ++ R N+ +++ Sbjct: 1 MLVDSHCHLDFAAFDNDRDFILARCRDLNIERIL 34 >gi|26987527|ref|NP_742952.1| TatD family deoxyribonuclease [Pseudomonas putida KT2440] gi|24982196|gb|AAN66416.1|AE016269_3 deoxyribonuclease, TatD family [Pseudomonas putida KT2440] Length = 258 Score = 42.3 bits (98), Expect = 0.022, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR ++ A + +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRPRLLANAAARGLERMVVLGV 39 >gi|304410256|ref|ZP_07391875.1| TatD-related deoxyribonuclease [Shewanella baltica OS183] gi|307302033|ref|ZP_07581791.1| TatD-related deoxyribonuclease [Shewanella baltica BA175] gi|304351665|gb|EFM16064.1| TatD-related deoxyribonuclease [Shewanella baltica OS183] gi|306914071|gb|EFN44492.1| TatD-related deoxyribonuclease [Shewanella baltica BA175] Length = 254 Score = 42.3 bits (98), Expect = 0.022, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ R H V +I Sbjct: 1 MIDTHAHLDFVEFDIDRDAVVQRMHSVGVDNLI 33 >gi|190575099|ref|YP_001972944.1| putative TatD related DNase [Stenotrophomonas maltophilia K279a] gi|190013021|emb|CAQ46653.1| putative TatD related DNase [Stenotrophomonas maltophilia K279a] Length = 257 Score = 42.3 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 22/37 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L+++HCH +FD DR VI RA A V + + A+ Sbjct: 4 LVDSHCHLDASEFDADRTAVIERAGAAGVREQVVPAV 40 >gi|283788415|ref|YP_003368280.1| putative deoxyribonuclease [Citrobacter rodentium ICC168] gi|282951869|emb|CBG91585.1| putative deoxyribonuclease [Citrobacter rodentium ICC168] Length = 258 Score = 42.3 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + RA QA V K++ A + Sbjct: 5 FIDTHCHFDFPPFTGDEQACLQRAAQAGVEKIVVPATE 42 >gi|117617593|ref|YP_858147.1| putative deoxyribonuclease [Aeromonas hydrophila subsp. hydrophila ATCC 7966] gi|117559000|gb|ABK35948.1| putative deoxyribonuclease [Aeromonas hydrophila subsp. hydrophila ATCC 7966] Length = 262 Score = 42.3 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+THCH P FD DR ++ Q V + I Sbjct: 3 LIDTHCHLDFPVFDPDRAALLAECRQLGVSEYI 35 >gi|294011649|ref|YP_003545109.1| Mg-dependent DNase [Sphingobium japonicum UT26S] gi|292674979|dbj|BAI96497.1| Mg-dependent DNase [Sphingobium japonicum UT26S] Length = 257 Score = 42.3 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 22/39 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I++HCH ED+ NV+ RA A V M+ IA + Sbjct: 1 MFIDSHCHLNYKGLVEDQQNVLERARGAGVGLMLNIATR 39 >gi|204927301|ref|ZP_03218503.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|204323966|gb|EDZ09161.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] Length = 257 Score = 42.3 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRAGEAGVEKIIVPATE 42 >gi|153001742|ref|YP_001367423.1| TatD-like deoxyribonuclease [Shewanella baltica OS185] gi|151366360|gb|ABS09360.1| TatD-related deoxyribonuclease [Shewanella baltica OS185] Length = 254 Score = 42.3 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ R V +I Sbjct: 1 MIDTHAHLDFAEFDLDRDAVVQRMRSVGVNNLI 33 >gi|302185876|ref|ZP_07262549.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. syringae 642] Length = 264 Score = 42.3 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRARVLDNCRTLGVQRMVVLGV 39 >gi|12837586|dbj|BAB23875.1| unnamed protein product [Mus musculus] Length = 189 Score = 42.3 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ RA +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLERARKANVMALVAVA 40 >gi|288801180|ref|ZP_06406635.1| deoxyribonuclease, TatD family [Prevotella sp. oral taxon 299 str. F0039] gi|288331791|gb|EFC70274.1| deoxyribonuclease, TatD family [Prevotella sp. oral taxon 299 str. F0039] Length = 261 Score = 42.3 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 20/32 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 L++TH H + DF +D V+ RA +A V +M Sbjct: 4 LVDTHAHLDVEDFSDDLQQVVQRAKEAGVGRM 35 >gi|217970672|ref|YP_002355906.1| TatD-related deoxyribonuclease [Thauera sp. MZ1T] gi|217507999|gb|ACK55010.1| TatD-related deoxyribonuclease [Thauera sp. MZ1T] Length = 263 Score = 42.3 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 +LI+TH H +FD+DR VI RA A V + + A++ Sbjct: 6 VLIDTHVHLDAAEFDDDREQVIARARAAGVGRFVVPAVE 44 >gi|86157741|ref|YP_464526.1| TatD-related deoxyribonuclease [Anaeromyxobacter dehalogenans 2CP-C] gi|85774252|gb|ABC81089.1| TatD-related deoxyribonuclease [Anaeromyxobacter dehalogenans 2CP-C] Length = 258 Score = 42.3 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 23/36 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI++H H L D+ D VI RA +A +++++ + Sbjct: 1 MLIDSHAHLDLDDYRGDLDAVISRAREAGLVRVVCV 36 >gi|296123865|ref|YP_003631643.1| hydrolase, TatD family [Planctomyces limnophilus DSM 3776] gi|296016205|gb|ADG69444.1| hydrolase, TatD family [Planctomyces limnophilus DSM 3776] Length = 262 Score = 42.3 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCH F +R +VI RA V +M++I Sbjct: 4 LFDTHCHLDEDAFLNERDDVIERAIALGVTRMLSIGT 40 >gi|311265029|ref|XP_003130453.1| PREDICTED: putative deoxyribonuclease TATDN3-like [Sus scrofa] Length = 253 Score = 42.3 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ +A +A+V+ ++ +A Sbjct: 8 LVDCHCHLSAPDFDHDLDDVLEKAKKASVMALVVVA 43 >gi|94496392|ref|ZP_01302969.1| TatD-related deoxyribonuclease [Sphingomonas sp. SKA58] gi|94424138|gb|EAT09162.1| TatD-related deoxyribonuclease [Sphingomonas sp. SKA58] Length = 257 Score = 42.3 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI++HCH ED+ NV+ R+ A V M+ IA + Sbjct: 1 MLIDSHCHLNYKGLIEDQKNVLERSRAAGVDLMLNIATR 39 >gi|313497154|gb|ADR58520.1| TatD family deoxyribonuclease [Pseudomonas putida BIRD-1] Length = 258 Score = 42.3 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR ++ A + +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRPRLLANAAARGLERMVVLGV 39 >gi|294101617|ref|YP_003553475.1| hydrolase, TatD family [Aminobacterium colombiense DSM 12261] gi|293616597|gb|ADE56751.1| hydrolase, TatD family [Aminobacterium colombiense DSM 12261] Length = 264 Score = 42.3 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++THCH D++ED VI RA + +M+ +A V Sbjct: 7 FVDTHCHLNSEDYNEDLDEVIERAKSQGLARMLVVAADV 45 >gi|311265027|ref|XP_003130451.1| PREDICTED: putative deoxyribonuclease TATDN3-like [Sus scrofa] Length = 274 Score = 42.3 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ +A +A+V+ ++ +A Sbjct: 8 LVDCHCHLSAPDFDHDLDDVLEKAKKASVMALVVVA 43 >gi|34496083|ref|NP_900298.1| deoxyribonuclease [Chromobacterium violaceum ATCC 12472] gi|34101937|gb|AAQ58304.1| probable deoxyribonuclease [Chromobacterium violaceum ATCC 12472] Length = 262 Score = 42.3 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH P+ D V+ RA A V +++ A+ Sbjct: 12 LIDSHCHLDAPELAPDVDGVVARARAAGVGQLLVPAV 48 >gi|77919293|ref|YP_357108.1| Mg-dependent DNase [Pelobacter carbinolicus DSM 2380] gi|77545376|gb|ABA88938.1| Mg-dependent DNase [Pelobacter carbinolicus DSM 2380] Length = 464 Score = 42.3 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 22/35 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+TH H +D+DR +VI RA Q+ + MI I Sbjct: 8 LIDTHAHLDSRQYDQDRQDVIQRALQSGITHMITI 42 >gi|148546059|ref|YP_001266161.1| TatD family hydrolase [Pseudomonas putida F1] gi|148510117|gb|ABQ76977.1| hydrolase, TatD family [Pseudomonas putida F1] Length = 258 Score = 42.3 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR ++ A + +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRPRLLANAAARGLERMVVLGV 39 >gi|327482268|gb|AEA85578.1| TatD family deoxyribonuclease [Pseudomonas stutzeri DSM 4166] Length = 259 Score = 41.9 bits (97), Expect = 0.027, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 22/37 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H FD+DR VI RA A V +++ + + Sbjct: 3 LIDTHTHLDFEMFDDDRAQVIARARNAGVERIVVLGV 39 >gi|311281047|ref|YP_003943278.1| TatD-related deoxyribonuclease [Enterobacter cloacae SCF1] gi|308750242|gb|ADO49994.1| TatD-related deoxyribonuclease [Enterobacter cloacae SCF1] Length = 259 Score = 41.9 bits (97), Expect = 0.027, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 23/41 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F +D + RA QA V ++I A + R Sbjct: 5 FIDTHCHFDFPPFVDDVPESLARAAQAGVEQIIIPATQASR 45 >gi|170289836|ref|YP_001736652.1| TatD-related deoxyribonuclease [Candidatus Korarchaeum cryptofilum OPF8] gi|170173916|gb|ACB06969.1| TatD-related deoxyribonuclease [Candidatus Korarchaeum cryptofilum OPF8] Length = 251 Score = 41.9 bits (97), Expect = 0.027, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIA 35 L + HCH FDEDR V+ RA ++ ++ ++ Sbjct: 3 LFDVHCHLEDESFDEDRDEVLERARKSGIVGIVT 36 >gi|16763359|ref|NP_458976.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|29144837|ref|NP_808179.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|213161922|ref|ZP_03347632.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] gi|213417865|ref|ZP_03350967.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750] gi|213427568|ref|ZP_03360318.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. E02-1180] gi|213613228|ref|ZP_03371054.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] gi|213647465|ref|ZP_03377518.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. J185] gi|213854148|ref|ZP_03382680.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. M223] gi|25318589|pir||AH1072 conserved hypothetical protein (EC 3.1.21.-) [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|16505668|emb|CAD03399.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] gi|29140476|gb|AAO72039.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] Length = 257 Score = 41.9 bits (97), Expect = 0.027, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|94969056|ref|YP_591104.1| TatD-related deoxyribonuclease [Candidatus Koribacter versatilis Ellin345] gi|94551106|gb|ABF41030.1| TatD-related deoxyribonuclease [Candidatus Koribacter versatilis Ellin345] Length = 267 Score = 41.9 bits (97), Expect = 0.028, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M +++HCH P F EDR VI+ A A V ++ I Sbjct: 1 MFVDSHCHLDGPRFAEDREAVILNACNAGVEHLLLI 36 >gi|330960797|gb|EGH61057.1| TatD family hydrolase [Pseudomonas syringae pv. maculicola str. ES4326] Length = 264 Score = 41.9 bits (97), Expect = 0.028, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ + V +M+ + + Sbjct: 3 LIDTHTHLDFADFDADRAQVLQHSQALGVQRMVVLGV 39 >gi|229588347|ref|YP_002870466.1| putative deoxyribonuclease [Pseudomonas fluorescens SBW25] gi|229360213|emb|CAY47070.1| putative deoxyribonuclease [Pseudomonas fluorescens SBW25] Length = 258 Score = 41.9 bits (97), Expect = 0.028, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H P FD DR +V+ + V +M+ + + Sbjct: 3 LIDTHTHLDFPAFDSDRRDVLAHSRTLGVRRMVVLGV 39 >gi|167628097|ref|YP_001678597.1| TatD family hydrolase [Francisella philomiragia subsp. philomiragia ATCC 25017] gi|167598098|gb|ABZ88096.1| TatD family hydrolase [Francisella philomiragia subsp. philomiragia ATCC 25017] Length = 248 Score = 41.9 bits (97), Expect = 0.028, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 19/39 (48%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R ++ ++ + I A + Sbjct: 1 MFIDTHCHLDFAIFDKTRDVILQNCNELGINHFINPATR 39 >gi|312173618|emb|CBX81872.1| Mg-dependent DNase [Erwinia amylovora ATCC BAA-2158] Length = 258 Score = 41.9 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ++THCHF P F D + RA QA V K+IA+++ Sbjct: 5 FVDTHCHFDFPPFVGDEQASLQRAAQAGVEKIIAVSV 41 >gi|262193793|ref|YP_003265002.1| hydrolase, TatD family [Haliangium ochraceum DSM 14365] gi|262077140|gb|ACY13109.1| hydrolase, TatD family [Haliangium ochraceum DSM 14365] Length = 264 Score = 41.9 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 I++H H DFD DR ++ RAH A V +++ + Sbjct: 3 FIDSHAHIDAADFDSDRPEMLARAHSAGVREIVCV 37 >gi|241668637|ref|ZP_04756215.1| TatD family hydrolase [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254877170|ref|ZP_05249880.1| tatD family hydrolase [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254843191|gb|EET21605.1| tatD family hydrolase [Francisella philomiragia subsp. philomiragia ATCC 25015] Length = 248 Score = 41.9 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 19/39 (48%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R ++ ++ + I A + Sbjct: 1 MFIDTHCHLDFAIFDKIRDAILQNCNELGINHFINPATR 39 >gi|291402417|ref|XP_002717566.1| PREDICTED: putative deoxyribonuclease TATDN3-like isoform 2 [Oryctolagus cuniculus] Length = 253 Score = 41.9 bits (97), Expect = 0.030, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 24/36 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ A + NV+ ++A+A Sbjct: 8 LVDCHCHLSAPDFDHDLDDVLEEAKKVNVMALVAVA 43 >gi|217972324|ref|YP_002357075.1| TatD-like deoxyribonuclease [Shewanella baltica OS223] gi|217497459|gb|ACK45652.1| TatD-related deoxyribonuclease [Shewanella baltica OS223] Length = 254 Score = 41.9 bits (97), Expect = 0.030, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ R V +I Sbjct: 1 MIDTHAHLDFAEFDLDRDAVVQRMRSVGVDNLI 33 >gi|169830261|ref|YP_001716243.1| TatD family hydrolase [Candidatus Desulforudis audaxviator MP104C] gi|169637105|gb|ACA58611.1| hydrolase, TatD family [Candidatus Desulforudis audaxviator MP104C] Length = 261 Score = 41.9 bits (97), Expect = 0.030, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L++TH H F DR V++RA A V +I +A Sbjct: 3 LVDTHAHLDHDRFAADRDAVLVRARNAGVGLIITVAS 39 >gi|322615729|gb|EFY12649.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322620577|gb|EFY17437.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322621796|gb|EFY18646.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322627521|gb|EFY24312.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322630828|gb|EFY27592.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] gi|322637954|gb|EFY34655.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322642224|gb|EFY38832.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322644945|gb|EFY41477.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322656635|gb|EFY52923.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322658707|gb|EFY54964.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322661851|gb|EFY58067.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322666403|gb|EFY62581.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322672441|gb|EFY68553.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322676251|gb|EFY72322.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322679660|gb|EFY75705.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322684370|gb|EFY80374.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|323191852|gb|EFZ77101.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323196677|gb|EFZ81824.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323200946|gb|EFZ86015.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323209343|gb|EFZ94276.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323212970|gb|EFZ97772.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323216713|gb|EGA01438.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323223327|gb|EGA07664.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] gi|323226146|gb|EGA10363.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323228799|gb|EGA12928.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323236590|gb|EGA20666.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323239910|gb|EGA23957.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323242043|gb|EGA26072.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323247516|gb|EGA31471.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323250618|gb|EGA34500.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323259347|gb|EGA42989.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] gi|323263775|gb|EGA47296.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323265631|gb|EGA49127.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323270076|gb|EGA53524.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] Length = 257 Score = 41.9 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|207859689|ref|YP_002246340.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|206711492|emb|CAR35877.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] Length = 257 Score = 41.9 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|110596795|ref|ZP_01385085.1| TatD-related deoxyribonuclease [Chlorobium ferrooxidans DSM 13031] gi|110341482|gb|EAT59942.1| TatD-related deoxyribonuclease [Chlorobium ferrooxidans DSM 13031] Length = 257 Score = 41.9 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ML++TH H PDFD DR +I R + V +I Sbjct: 1 MLVDTHAHLSFPDFDNDRKEIIERLCREGVRLLI 34 >gi|168244539|ref|ZP_02669471.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|194448325|ref|YP_002048584.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194406629|gb|ACF66848.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|205336592|gb|EDZ23356.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] Length = 257 Score = 41.9 bits (97), Expect = 0.033, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|237802060|ref|ZP_04590521.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. oryzae str. 1_6] gi|331024916|gb|EGI04972.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. oryzae str. 1_6] Length = 266 Score = 41.9 bits (97), Expect = 0.033, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD+DR+ V+ V +M+ + + Sbjct: 5 LIDTHTHLDFSDFDDDRNQVLEHCSSLGVQRMVVLGV 41 >gi|188532812|ref|YP_001906609.1| Mg-dependent DNase [Erwinia tasmaniensis Et1/99] gi|188027854|emb|CAO95711.1| Mg-dependent DNase [Erwinia tasmaniensis Et1/99] Length = 258 Score = 41.9 bits (97), Expect = 0.033, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 22/41 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++THCHF P F D + RA A V K+IA+ + R Sbjct: 5 FVDTHCHFDFPPFVGDEEASLARAAHAGVEKIIAVGVSAPR 45 >gi|56416338|ref|YP_153413.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197365260|ref|YP_002144897.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|56130595|gb|AAV80101.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197096737|emb|CAR62360.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] Length = 257 Score = 41.9 bits (97), Expect = 0.033, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|301024958|ref|ZP_07188568.1| hydrolase, TatD family [Escherichia coli MS 69-1] gi|300396288|gb|EFJ79826.1| hydrolase, TatD family [Escherichia coli MS 69-1] Length = 259 Score = 41.5 bits (96), Expect = 0.034, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 20/40 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F D + A QA V K+I A + Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQCAAQAGVGKIIVPATEAE 44 >gi|186476202|ref|YP_001857672.1| TatD-related deoxyribonuclease [Burkholderia phymatum STM815] gi|184192661|gb|ACC70626.1| TatD-related deoxyribonuclease [Burkholderia phymatum STM815] Length = 262 Score = 41.5 bits (96), Expect = 0.034, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDASEFDADRDTVASAAFDAGVSRIV 34 >gi|294674495|ref|YP_003575111.1| NUDIX family hydrolase [Prevotella ruminicola 23] gi|294474293|gb|ADE83682.1| hydrolase, TatD family [Prevotella ruminicola 23] Length = 259 Score = 41.5 bits (96), Expect = 0.034, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 18/29 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANV 30 +I+THCH +F ED VI RA +A V Sbjct: 1 MIDTHCHIDGEEFVEDIDEVIARAREAGV 29 >gi|205355283|ref|YP_002229084.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|205275064|emb|CAR40152.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|326630449|gb|EGE36792.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Gallinarum str. 9] Length = 257 Score = 41.5 bits (96), Expect = 0.034, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|320160875|ref|YP_004174099.1| putative DNase [Anaerolinea thermophila UNI-1] gi|319994728|dbj|BAJ63499.1| putative DNase [Anaerolinea thermophila UNI-1] Length = 266 Score = 41.5 bits (96), Expect = 0.035, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 22/43 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTL 44 L +THCH F+ D V+ RA + V K++ I V ++ Sbjct: 6 LADTHCHLNFNTFESDLEEVLERAFETGVQKILVPGIDVETSI 48 >gi|292489451|ref|YP_003532338.1| mg-dependent DNase [Erwinia amylovora CFBP1430] gi|292898335|ref|YP_003537704.1| TatD related DNase [Erwinia amylovora ATCC 49946] gi|291198183|emb|CBJ45289.1| TatD related DNase [Erwinia amylovora ATCC 49946] gi|291554885|emb|CBA22800.1| Mg-dependent DNase [Erwinia amylovora CFBP1430] Length = 258 Score = 41.5 bits (96), Expect = 0.035, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ++THCHF P F D + RA QA V K+IA+++ Sbjct: 5 FVDTHCHFDFPPFVGDEQASLQRAAQAGVEKIIAVSV 41 >gi|170694754|ref|ZP_02885905.1| TatD-related deoxyribonuclease [Burkholderia graminis C4D1M] gi|170140385|gb|EDT08562.1| TatD-related deoxyribonuclease [Burkholderia graminis C4D1M] Length = 262 Score = 41.5 bits (96), Expect = 0.035, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR +V A A V +++ AI Sbjct: 1 MWIDTHCHLDASEFDADREHVATAARGAGVGRIVIPAI 38 >gi|168464518|ref|ZP_02698421.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|195632653|gb|EDX51107.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Newport str. SL317] Length = 257 Score = 41.5 bits (96), Expect = 0.035, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|194446554|ref|YP_002043805.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194405217|gb|ACF65439.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Newport str. SL254] Length = 257 Score = 41.5 bits (96), Expect = 0.035, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|149377283|ref|ZP_01895030.1| Sec-independent protein translocase protein TatD [Marinobacter algicola DG893] gi|149358471|gb|EDM46946.1| Sec-independent protein translocase protein TatD [Marinobacter algicola DG893] Length = 262 Score = 41.5 bits (96), Expect = 0.035, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI+ HCHF P+FD R V+ A + ++ ++ Sbjct: 3 LIDAHCHFDFPEFDGRRKAVLEDARSVGLSHLVIPGVR 40 >gi|291402415|ref|XP_002717565.1| PREDICTED: putative deoxyribonuclease TATDN3-like isoform 1 [Oryctolagus cuniculus] Length = 273 Score = 41.5 bits (96), Expect = 0.035, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 24/36 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH PDFD D +V+ A + NV+ ++A+A Sbjct: 8 LVDCHCHLSAPDFDHDLDDVLEEAKKVNVMALVAVA 43 >gi|148681062|gb|EDL13009.1| mCG14106, isoform CRA_c [Mus musculus] Length = 205 Score = 41.5 bits (96), Expect = 0.035, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 21 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 56 >gi|300087943|ref|YP_003758465.1| hydrolase, TatD family [Dehalogenimonas lykanthroporepellens BL-DC-9] gi|299527676|gb|ADJ26144.1| hydrolase, TatD family [Dehalogenimonas lykanthroporepellens BL-DC-9] Length = 261 Score = 41.5 bits (96), Expect = 0.035, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 22/42 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 LI++H H L F D V+ RA A + ++I I I + + Sbjct: 5 LIDSHAHLDLSQFSADLDAVLKRATDAGISRIITIGIDLRSS 46 >gi|325858533|ref|ZP_08172637.1| hydrolase, TatD family [Prevotella denticola CRIS 18C-A] gi|327314325|ref|YP_004329762.1| TatD family hydrolase [Prevotella denticola F0289] gi|325483030|gb|EGC86019.1| hydrolase, TatD family [Prevotella denticola CRIS 18C-A] gi|326944183|gb|AEA20068.1| hydrolase, TatD family [Prevotella denticola F0289] Length = 271 Score = 41.5 bits (96), Expect = 0.036, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 23/41 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M+I+TH H DF D VI RAH+A V K+ A+ + Sbjct: 1 MIIDTHAHLDTEDFKADLPEVIRRAHEAGVGKIFLPAVDLK 41 >gi|237729277|ref|ZP_04559758.1| conserved hypothetical protein [Citrobacter sp. 30_2] gi|226909006|gb|EEH94924.1| conserved hypothetical protein [Citrobacter sp. 30_2] Length = 258 Score = 41.5 bits (96), Expect = 0.036, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 19/38 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA + V +I A + Sbjct: 5 FIDTHCHFDFPPFTGDESASIQRAAEVGVQSIIVPATQ 42 >gi|213582898|ref|ZP_03364724.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664] Length = 61 Score = 41.5 bits (96), Expect = 0.036, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|168234699|ref|ZP_02659757.1| hydrolase, TatD family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|194737126|ref|YP_002117479.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|194712628|gb|ACF91849.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197291890|gb|EDY31240.1| hydrolase, TatD family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] Length = 257 Score = 41.5 bits (96), Expect = 0.037, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|168230209|ref|ZP_02655267.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|194471290|ref|ZP_03077274.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|200388450|ref|ZP_03215062.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|194457654|gb|EDX46493.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|199605548|gb|EDZ04093.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|205335015|gb|EDZ21779.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] Length = 257 Score = 41.5 bits (96), Expect = 0.037, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|62182982|ref|YP_219399.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|167552211|ref|ZP_02345964.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|168262383|ref|ZP_02684356.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|197250197|ref|YP_002149505.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197265767|ref|ZP_03165841.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|198242234|ref|YP_002218439.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|224586385|ref|YP_002640184.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|62130615|gb|AAX68318.1| putative hydrolase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|197213900|gb|ACH51297.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197244022|gb|EDY26642.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|197936750|gb|ACH74083.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|205323107|gb|EDZ10946.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205348921|gb|EDZ35552.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|224470913|gb|ACN48743.1| hypothetical protein SPC_4700 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|322717489|gb|EFZ09060.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] gi|326626246|gb|EGE32591.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Dublin str. 3246] Length = 257 Score = 41.5 bits (96), Expect = 0.037, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|238910723|ref|ZP_04654560.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] Length = 257 Score = 41.5 bits (96), Expect = 0.037, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|157147613|ref|YP_001454932.1| putative deoxyribonuclease YjjV [Citrobacter koseri ATCC BAA-895] gi|157084818|gb|ABV14496.1| hypothetical protein CKO_03413 [Citrobacter koseri ATCC BAA-895] Length = 258 Score = 41.5 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 I+THCHF P F D I RA A V K+I A Sbjct: 5 FIDTHCHFDFPPFTGDEAASIQRAADAGVGKIIVPAT 41 >gi|82779629|ref|YP_405978.1| putative deoxyribonuclease YjjV [Shigella dysenteriae Sd197] gi|309787402|ref|ZP_07682014.1| uncharacterized deoxyribonuclease yjjV [Shigella dysenteriae 1617] gi|81243777|gb|ABB64487.1| Mg-dependent DNase [Shigella dysenteriae Sd197] gi|308924980|gb|EFP70475.1| uncharacterized deoxyribonuclease yjjV [Shigella dysenteriae 1617] Length = 260 Score = 41.5 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 20/40 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFLPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|82546727|ref|YP_410674.1| deoxyribonuclease YjjV [Shigella boydii Sb227] gi|81248138|gb|ABB68846.1| Mg-dependent DNase [Shigella boydii Sb227] gi|320183340|gb|EFW58194.1| Putative deoxyribonuclease YjjV [Shigella flexneri CDC 796-83] gi|332090299|gb|EGI95397.1| hypothetical protein SB359474_4047 [Shigella boydii 3594-74] Length = 260 Score = 41.5 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 20/40 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF F D + RA QA V K+I A + Sbjct: 5 FIDTHCHFDFLPFSGDEEASLQRAAQAGVGKIIVPATEAE 44 >gi|16767805|ref|NP_463420.1| deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|167989805|ref|ZP_02570905.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|16423129|gb|AAL23379.1| putative hydrolase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|205331289|gb|EDZ18053.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|267996926|gb|ACY91811.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301161043|emb|CBW20580.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|312915658|dbj|BAJ39632.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|321222467|gb|EFX47539.1| Putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|323132904|gb|ADX20334.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] Length = 257 Score = 41.5 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|168822107|ref|ZP_02834107.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|205341399|gb|EDZ28163.1| hydrolase, TatD family [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|320088996|emb|CBY98752.1| putative deoxyribonuclease [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] Length = 257 Score = 41.5 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|71898610|ref|ZP_00680780.1| TatD-related deoxyribonuclease [Xylella fastidiosa Ann-1] gi|71731557|gb|EAO33618.1| TatD-related deoxyribonuclease [Xylella fastidiosa Ann-1] Length = 260 Score = 41.5 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +LI++HCH FD DR +I RA A V+ + Sbjct: 4 VLIDSHCHLDADAFDGDRAEIIARAQAAGVIAQV 37 >gi|85708669|ref|ZP_01039735.1| Mg-dependent DNase [Erythrobacter sp. NAP1] gi|85690203|gb|EAQ30206.1| Mg-dependent DNase [Erythrobacter sp. NAP1] Length = 258 Score = 41.5 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 ML+++HCH ED+ V+ RA +A V + I+ K Sbjct: 1 MLVDSHCHLEYKGLVEDQAGVLSRAREAGVGAFLNISTK 39 >gi|229828785|ref|ZP_04454854.1| hypothetical protein GCWU000342_00859 [Shuttleworthia satelles DSM 14600] gi|229793379|gb|EEP29493.1| hypothetical protein GCWU000342_00859 [Shuttleworthia satelles DSM 14600] Length = 282 Score = 41.5 bits (96), Expect = 0.042, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 22/43 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 M+ TH H +FD+DR V+ R +A + ++ + + + Sbjct: 1 MIFETHAHLDGEEFDQDREEVLARVREAGISHLVNVGSDIKSS 43 >gi|281421200|ref|ZP_06252199.1| putative hydrolase [Prevotella copri DSM 18205] gi|281404735|gb|EFB35415.1| putative hydrolase [Prevotella copri DSM 18205] Length = 279 Score = 41.5 bits (96), Expect = 0.042, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 24/42 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 +I+TH HF +FDEDR RA +A V K+ AI V T Sbjct: 4 VIDTHTHFDAEEFDEDRAEAFARAKEAGVGKVFLPAIDVKTT 45 >gi|189426504|ref|YP_001953681.1| TatD-related deoxyribonuclease [Geobacter lovleyi SZ] gi|189422763|gb|ACD97161.1| TatD-related deoxyribonuclease [Geobacter lovleyi SZ] Length = 251 Score = 41.5 bits (96), Expect = 0.043, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 MLI+THCH LP E ++ A V K + ++ Sbjct: 1 MLIDTHCHLDLPPLFEQLDELLAEARAVGVAKWVVPSV 38 >gi|147669461|ref|YP_001214279.1| TatD family hydrolase [Dehalococcoides sp. BAV1] gi|289432728|ref|YP_003462601.1| hydrolase, TatD family [Dehalococcoides sp. GT] gi|146270409|gb|ABQ17401.1| hydrolase, TatD family [Dehalococcoides sp. BAV1] gi|288946448|gb|ADC74145.1| hydrolase, TatD family [Dehalococcoides sp. GT] Length = 264 Score = 41.5 bits (96), Expect = 0.043, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 21/38 (55%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++TH H + +FD DR ++ RA+ V +I I + Sbjct: 7 VDTHAHLDMAEFDADRSEMLKRAYDNGVKTIITTGIDI 44 >gi|325269798|ref|ZP_08136408.1| TatD family deoxyribonuclease [Prevotella multiformis DSM 16608] gi|324987771|gb|EGC19744.1| TatD family deoxyribonuclease [Prevotella multiformis DSM 16608] Length = 271 Score = 41.1 bits (95), Expect = 0.045, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 24/41 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M+I+TH H + DF D V+ RAH+A V K+ AI + Sbjct: 1 MIIDTHAHLDVEDFKTDLPEVVRRAHEAGVGKIFLPAIDLK 41 >gi|255604278|ref|XP_002538196.1| Deoxyribonuclease tatD, putative [Ricinus communis] gi|223513341|gb|EEF24187.1| Deoxyribonuclease tatD, putative [Ricinus communis] Length = 270 Score = 41.1 bits (95), Expect = 0.045, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L++THCH +F DR +++RA QA V ++ Sbjct: 12 LVDTHCHLDATEFGPDRDQLVVRARQAAVGAIV 44 >gi|238927711|ref|ZP_04659471.1| TatD deoxyribonuclease [Selenomonas flueggei ATCC 43531] gi|238884427|gb|EEQ48065.1| TatD deoxyribonuclease [Selenomonas flueggei ATCC 43531] Length = 257 Score = 41.1 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 18/35 (51%), Positives = 25/35 (71%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+TH H FD+DR +VI RAH+A V K+I++ Sbjct: 3 LIDTHAHLCDEKFDDDRIDVIARAHEAGVTKIISM 37 >gi|88858295|ref|ZP_01132937.1| putative hydrolase with metallo-dependent hydrolase domain [Pseudoalteromonas tunicata D2] gi|88819912|gb|EAR29725.1| putative hydrolase with metallo-dependent hydrolase domain [Pseudoalteromonas tunicata D2] Length = 270 Score = 41.1 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 24/45 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL 46 LI++HCH +FD +R +I Q ++ +I + ++L L Sbjct: 18 LIDSHCHLDFSEFDSNRGELITSCQQQGIISLIVPGVSAQQSLSL 62 >gi|126665267|ref|ZP_01736250.1| putative deoxyribonuclease [Marinobacter sp. ELB17] gi|126630637|gb|EBA01252.1| putative deoxyribonuclease [Marinobacter sp. ELB17] Length = 239 Score = 41.1 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 19/39 (48%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 ML++ HCHF P FD R ++ + ++ ++ Sbjct: 1 MLVDVHCHFDFPQFDGRREQLMGELRGQGIGGLVIPGVR 39 >gi|66044074|ref|YP_233915.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. syringae B728a] gi|63254781|gb|AAY35877.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. syringae B728a] Length = 264 Score = 41.1 bits (95), Expect = 0.047, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +++ + + Sbjct: 3 LIDTHTHLDFPDFDADRTQVLENCLALGVQRLVVLGV 39 >gi|330973700|gb|EGH73766.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. aceris str. M302273PT] Length = 264 Score = 41.1 bits (95), Expect = 0.048, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +++ + + Sbjct: 3 LIDTHTHLDFPDFDADRTQVLENCLALGVQRLVVLGV 39 >gi|116754599|ref|YP_843717.1| TatD family hydrolase [Methanosaeta thermophila PT] gi|116666050|gb|ABK15077.1| hydrolase, TatD family [Methanosaeta thermophila PT] Length = 251 Score = 41.1 bits (95), Expect = 0.048, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 22/33 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+ HCH F++DR +VI RA + V++MI Sbjct: 4 VIDAHCHLDFKHFNKDRMDVIERARASGVVEMI 36 >gi|330967189|gb|EGH67449.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. actinidiae str. M302091] Length = 267 Score = 41.1 bits (95), Expect = 0.049, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +M+ + + Sbjct: 5 LIDTHTHLDFPDFDADRAQVLEHCRSLCVQRMVVLGV 41 >gi|152990521|ref|YP_001356243.1| TatD family hydrolase [Nitratiruptor sp. SB155-2] gi|151422382|dbj|BAF69886.1| hydrolase, TatD family [Nitratiruptor sp. SB155-2] Length = 256 Score = 41.1 bits (95), Expect = 0.049, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+TH H F ED VI RA +A V + I Sbjct: 1 MIIDTHTHLDHKMFQEDVDEVIQRAKEAGVKRFI 34 >gi|327398337|ref|YP_004339206.1| TatD family hydrolase [Hippea maritima DSM 10411] gi|327180966|gb|AEA33147.1| hydrolase, TatD family [Hippea maritima DSM 10411] Length = 255 Score = 41.1 bits (95), Expect = 0.050, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 19/29 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANV 30 +I+THCH + +F++DR VI R+ V Sbjct: 4 IIDTHCHIDMEEFEQDRDEVIQRSKAGGV 32 >gi|197294724|ref|YP_001799265.1| Mg-dependent DNase [Candidatus Phytoplasma australiense] gi|171854051|emb|CAM12024.1| Mg-dependent DNase [Candidatus Phytoplasma australiense] Length = 255 Score = 41.1 bits (95), Expect = 0.050, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 24/36 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H + ++D+D V+ RA Q +V KMI + Sbjct: 1 MLIDTHAHLNVANYDKDLDEVLKRAFQNDVKKMIVV 36 >gi|167646659|ref|YP_001684322.1| TatD family hydrolase [Caulobacter sp. K31] gi|167349089|gb|ABZ71824.1| hydrolase, TatD family [Caulobacter sp. K31] Length = 264 Score = 41.1 bits (95), Expect = 0.050, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 23/40 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++H + +DEDR VI RA A + M+ I K+ Sbjct: 1 MLIDSHVNLHAHQYDEDRQAVIDRARAAGIALMVTICDKI 40 >gi|297538272|ref|YP_003674041.1| TatD-like deoxyribonuclease [Methylotenera sp. 301] gi|297257619|gb|ADI29464.1| TatD-related deoxyribonuclease [Methylotenera sp. 301] Length = 270 Score = 41.1 bits (95), Expect = 0.053, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI+THCH +F+ DR+++ + A Q V ++ Sbjct: 1 MLIDTHCHLDAAEFNADRNDIALLALQQGVSNIV 34 >gi|213027246|ref|ZP_03341693.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] Length = 125 Score = 41.1 bits (95), Expect = 0.053, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATE 42 >gi|332185193|ref|ZP_08386942.1| hydrolase, TatD family protein [Sphingomonas sp. S17] gi|332014917|gb|EGI56973.1| hydrolase, TatD family protein [Sphingomonas sp. S17] Length = 258 Score = 41.1 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 ML ++HCH E++ ++ RA V M+ I+ + Sbjct: 1 MLADSHCHLNYKGLAEEQGAILKRARDRGVTAMLNISTR 39 >gi|254540126|ref|NP_001156894.1| putative deoxyribonuclease TATDN3 isoform 3 [Mus musculus] Length = 189 Score = 41.1 bits (95), Expect = 0.055, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L++ HCH DFD D +V+ +A +ANV+ ++A+A Sbjct: 5 LVDCHCHLSASDFDNDLDDVLEKARKANVMALVAVA 40 >gi|92113952|ref|YP_573880.1| TatD-related deoxyribonuclease [Chromohalobacter salexigens DSM 3043] gi|91797042|gb|ABE59181.1| TatD-related deoxyribonuclease [Chromohalobacter salexigens DSM 3043] Length = 255 Score = 41.1 bits (95), Expect = 0.055, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 18/41 (43%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 LI+ HCH FD DR +V+ RA V I R Sbjct: 5 LIDAHCHLDFDVFDADREDVMSRAAAVGVGHFIVPGTTRRR 45 >gi|330954346|gb|EGH54606.1| TatD-related deoxyribonuclease [Pseudomonas syringae Cit 7] Length = 266 Score = 40.7 bits (94), Expect = 0.058, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR V+ V +M+ + + Sbjct: 5 LIDTHTHLDFPDFDADRAQVLDNCLTLGVERMVVLGV 41 >gi|293606102|ref|ZP_06688467.1| hydrogenase nickel insertion protein HypA [Achromobacter piechaudii ATCC 43553] gi|292815557|gb|EFF74673.1| hydrogenase nickel insertion protein HypA [Achromobacter piechaudii ATCC 43553] Length = 272 Score = 40.7 bits (94), Expect = 0.060, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI+THCH +FD DR V A +A V ++ AI+ Sbjct: 1 MLIDTHCHLDAAEFDADRAQVADHACEAGVRSIVIPAIE 39 >gi|283780921|ref|YP_003371676.1| hydrolase, TatD family [Pirellula staleyi DSM 6068] gi|283439374|gb|ADB17816.1| hydrolase, TatD family [Pirellula staleyi DSM 6068] Length = 264 Score = 40.7 bits (94), Expect = 0.061, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 21/41 (51%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTL 44 +THCH +VI RA A V +++++A V TL Sbjct: 8 DTHCHLADEQLASQADDVIARASSAGVAELLSVATDVRSTL 48 >gi|15836782|ref|NP_297470.1| hypothetical protein XF0177 [Xylella fastidiosa 9a5c] gi|9104976|gb|AAF82990.1|AE003872_1 conserved hypothetical protein [Xylella fastidiosa 9a5c] Length = 260 Score = 40.7 bits (94), Expect = 0.061, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +LI++HCH FD DR +I RA A ++ + Sbjct: 4 VLIDSHCHLDADAFDGDRAEIIARAQAAGIIAQV 37 >gi|225025036|ref|ZP_03714228.1| hypothetical protein EIKCOROL_01925 [Eikenella corrodens ATCC 23834] gi|224942266|gb|EEG23475.1| hypothetical protein EIKCOROL_01925 [Eikenella corrodens ATCC 23834] Length = 256 Score = 40.7 bits (94), Expect = 0.063, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 MLI++HCH PD + V+ +A V K IAI++ Sbjct: 1 MLIDSHCHLNFPDLAQRLPEVLANMAEAGVDKAIAISV 38 >gi|161617876|ref|YP_001591841.1| putative deoxyribonuclease YjjV [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|161367240|gb|ABX71008.1| hypothetical protein SPAB_05743 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] Length = 257 Score = 40.7 bits (94), Expect = 0.064, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D I RA +A V K+I A + Sbjct: 5 FIDTHCHFDFPPFTGDERVSIQRACEAGVEKIIVPATE 42 >gi|91763267|ref|ZP_01265231.1| TatD related DNase [Candidatus Pelagibacter ubique HTCC1002] gi|91717680|gb|EAS84331.1| TatD related DNase [Candidatus Pelagibacter ubique HTCC1002] Length = 258 Score = 40.7 bits (94), Expect = 0.066, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +I++HCH E+ + VI R+ +A + K++ I + Sbjct: 5 MIDSHCHLDHEPLLENLNEVIKRSKEAGISKLLTICTTLE 44 >gi|56460978|ref|YP_156259.1| Mg-dependent DNase-like protein [Idiomarina loihiensis L2TR] gi|56179988|gb|AAV82710.1| Mg-dependent DNase homolog [Idiomarina loihiensis L2TR] Length = 265 Score = 40.7 bits (94), Expect = 0.066, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCH FDEDR V+ A +A V + + Sbjct: 4 LYDTHCHIDFQAFDEDREQVLEAAAEAGVERFM 36 >gi|304438287|ref|ZP_07398228.1| TatD family hydrolase [Selenomonas sp. oral taxon 149 str. 67H29BP] gi|304368653|gb|EFM22337.1| TatD family hydrolase [Selenomonas sp. oral taxon 149 str. 67H29BP] Length = 261 Score = 40.7 bits (94), Expect = 0.066, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 24/35 (68%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+TH H FD+DR +VI RA +A V K+I++ Sbjct: 3 LIDTHAHLCDEKFDDDRSDVIARAREAGVTKIISM 37 >gi|294083929|ref|YP_003550686.1| Mg-dependent DNase [Candidatus Puniceispirillum marinum IMCC1322] gi|292663501|gb|ADE38602.1| Mg-dependent DNase [Candidatus Puniceispirillum marinum IMCC1322] Length = 263 Score = 40.7 bits (94), Expect = 0.069, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I++H H P F ++ +I RA A V ++I+I +K+ Sbjct: 7 IIDSHAHLDYPQFADELPQIIARAGDAGVERIISIGVKL 45 >gi|302346895|ref|YP_003815193.1| hydrolase, TatD family [Prevotella melaninogenica ATCC 25845] gi|302150619|gb|ADK96880.1| hydrolase, TatD family [Prevotella melaninogenica ATCC 25845] Length = 271 Score = 40.7 bits (94), Expect = 0.070, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 24/41 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M+I+TH H + DF +D VI AH+A V K+ AI + Sbjct: 1 MIIDTHAHLDVEDFADDLPEVISHAHEAGVGKIFLPAIDLK 41 >gi|71083693|ref|YP_266413.1| TatD related DNase [Candidatus Pelagibacter ubique HTCC1062] gi|71062806|gb|AAZ21809.1| TatD related DNase [Candidatus Pelagibacter ubique HTCC1062] Length = 254 Score = 40.7 bits (94), Expect = 0.071, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 +I++HCH E+ + VI R+ +A + K++ I Sbjct: 1 MIDSHCHLDHEPLLENLNEVIKRSKEAGISKLLTICT 37 >gi|226943343|ref|YP_002798416.1| TatD-related deoxyribonuclease [Azotobacter vinelandii DJ] gi|226718270|gb|ACO77441.1| TatD-related deoxyribonuclease [Azotobacter vinelandii DJ] Length = 259 Score = 40.7 bits (94), Expect = 0.072, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+TH H DFD DR V+ R+ V + + Sbjct: 3 LIDTHNHLDFSDFDADRAAVLSRSRALGVDRQV 35 >gi|290476521|ref|YP_003469426.1| putative hydrolase with metallo-dependent hydrolase domain [Xenorhabdus bovienii SS-2004] gi|289175859|emb|CBJ82662.1| putative hydrolase with metallo-dependent hydrolase domain [Xenorhabdus bovienii SS-2004] Length = 256 Score = 40.7 bits (94), Expect = 0.073, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCHF P F + + +A QA V +I Sbjct: 1 MFIDTHCHFDFPPFTGNEQTSLKQARQAGVETII 34 >gi|254525533|ref|ZP_05137585.1| putative deoxyribonuclease, hydrolase [Prochlorococcus marinus str. MIT 9202] gi|221536957|gb|EEE39410.1| putative deoxyribonuclease, hydrolase [Prochlorococcus marinus str. MIT 9202] Length = 264 Score = 40.3 bits (93), Expect = 0.078, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI++HCH + +FD+D +V++R V K++ Sbjct: 6 LIDSHCHLIFENFDKDLEDVVLRLRSRGVKKLVHAC 41 >gi|157414088|ref|YP_001484954.1| TatD family deoxyribonuclease [Prochlorococcus marinus str. MIT 9215] gi|157388663|gb|ABV51368.1| possible deoxyribonuclease, TatD family [Prochlorococcus marinus str. MIT 9215] Length = 264 Score = 40.3 bits (93), Expect = 0.078, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 22/36 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI++HCH + +FD+D +V++R V K++ Sbjct: 6 LIDSHCHLIFENFDKDLEDVVLRLRSRGVKKLVHAC 41 >gi|123966899|ref|YP_001011980.1| TatD family deoxyribonuclease [Prochlorococcus marinus str. MIT 9515] gi|123201265|gb|ABM72873.1| possible deoxyribonuclease, TatD family [Prochlorococcus marinus str. MIT 9515] Length = 264 Score = 40.3 bits (93), Expect = 0.080, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 21/36 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI++HCH + +F++D V+ R+ V K++ Sbjct: 6 LIDSHCHLIFENFEKDLEEVVSRSRSIGVKKLLHAC 41 >gi|78779963|ref|YP_398075.1| putative deoxyribonuclease, TatD family [Prochlorococcus marinus str. MIT 9312] gi|78713462|gb|ABB50639.1| TatD-related deoxyribonuclease [Prochlorococcus marinus str. MIT 9312] Length = 264 Score = 40.3 bits (93), Expect = 0.080, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 21/36 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI++HCH + +FD+D +V+ R V K++ Sbjct: 6 LIDSHCHLIFENFDKDLEDVVCRLRSKGVKKLVHAC 41 >gi|317406530|gb|EFV86730.1| deoxyribonuclease [Achromobacter xylosoxidans C54] Length = 249 Score = 40.3 bits (93), Expect = 0.081, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 22/39 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI+THCH +FD DR V A + V ++ AI+ Sbjct: 1 MLIDTHCHLDAAEFDADRPEVAAHALDSGVQAIVIPAIE 39 >gi|315606369|ref|ZP_07881384.1| TatD family hydrolase [Prevotella buccae ATCC 33574] gi|315251775|gb|EFU31749.1| TatD family hydrolase [Prevotella buccae ATCC 33574] Length = 263 Score = 40.3 bits (93), Expect = 0.081, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 M+I+TH H + DF D V+ RA +A V K+ Sbjct: 1 MMIDTHAHLDVEDFHADLPEVMARAREAGVEKV 33 >gi|71275489|ref|ZP_00651775.1| TatD-related deoxyribonuclease [Xylella fastidiosa Dixon] gi|71163789|gb|EAO13505.1| TatD-related deoxyribonuclease [Xylella fastidiosa Dixon] Length = 277 Score = 40.3 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +LI++HCH FD DR +I RA V+ + Sbjct: 21 VLIDSHCHLDADAFDGDRAEIIARAQATGVIAQV 54 >gi|317151949|ref|YP_004119997.1| hydrolase, TatD family [Desulfovibrio aespoeensis Aspo-2] gi|316942200|gb|ADU61251.1| hydrolase, TatD family [Desulfovibrio aespoeensis Aspo-2] Length = 272 Score = 40.3 bits (93), Expect = 0.090, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 + +H H L DFD DR ++ RA + + +I + Sbjct: 20 VESHAHLDLEDFDGDREAILERARKTGISHLINV 53 >gi|71900644|ref|ZP_00682769.1| TatD-related deoxyribonuclease [Xylella fastidiosa Ann-1] gi|170729384|ref|YP_001774817.1| putative deoxyribonuclease [Xylella fastidiosa M12] gi|71729579|gb|EAO31685.1| TatD-related deoxyribonuclease [Xylella fastidiosa Ann-1] gi|167964177|gb|ACA11187.1| putative deoxyribonuclease [Xylella fastidiosa M12] Length = 260 Score = 40.3 bits (93), Expect = 0.090, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +LI++HCH FD DR +I RA V+ + Sbjct: 4 VLIDSHCHLDADAFDGDRAEIIARAQATGVIAQV 37 >gi|118474075|ref|YP_892350.1| YabD [Campylobacter fetus subsp. fetus 82-40] gi|118413301|gb|ABK81721.1| YabD [Campylobacter fetus subsp. fetus 82-40] Length = 254 Score = 40.3 bits (93), Expect = 0.091, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+THCH +DED V+ A + + K+I Sbjct: 1 MIIDTHCHLDDERYDEDLDAVLENAFKNGIKKII 34 >gi|282859642|ref|ZP_06268744.1| hydrolase, TatD family [Prevotella bivia JCVIHMP010] gi|282587560|gb|EFB92763.1| hydrolase, TatD family [Prevotella bivia JCVIHMP010] Length = 268 Score = 40.3 bits (93), Expect = 0.092, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M+I+TH H + D+ ED VI RA + V K+ +I Sbjct: 1 MIIDTHAHLDVEDYSEDLPEVIARAKETGVKKIFIPSI 38 >gi|37524525|ref|NP_927869.1| hypothetical protein plu0517 [Photorhabdus luminescens subsp. laumondii TTO1] gi|36783949|emb|CAE12812.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] Length = 257 Score = 40.3 bits (93), Expect = 0.092, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCHF P F +D + RA Q V ++I AI Sbjct: 1 MFIDTHCHFDFPPFRDDEQQSLQRAAQVGVDRIIVPAI 38 >gi|298674018|ref|YP_003725768.1| TatD family hydrolase [Methanohalobium evestigatum Z-7303] gi|298287006|gb|ADI72972.1| hydrolase, TatD family [Methanohalobium evestigatum Z-7303] Length = 253 Score = 40.3 bits (93), Expect = 0.093, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I++HCH F++DR I RA+ V ++I Sbjct: 5 IIDSHCHLDFKKFNKDREEAIERANLNGVTELI 37 >gi|157804068|ref|YP_001492617.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia canadensis str. McKiel] gi|157785331|gb|ABV73832.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia canadensis str. McKiel] Length = 269 Score = 40.3 bits (93), Expect = 0.095, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 23/41 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +LI++HCH L + D +VI RA + NV M I K+ Sbjct: 5 ILIDSHCHLNLLTKNTDLDSVIQRALENNVQYMQTICTKLE 45 >gi|89072590|ref|ZP_01159162.1| hypothetical protein SKA34_18734 [Photobacterium sp. SKA34] gi|89051694|gb|EAR57147.1| hypothetical protein SKA34_18734 [Photobacterium sp. SKA34] Length = 260 Score = 40.3 bits (93), Expect = 0.096, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCHF P F++D + A + V +++ Sbjct: 1 MIDTHCHFDFPPFNDDPEQALSLAQEGGVKQIL 33 >gi|124022145|ref|YP_001016452.1| deoxyribonuclease, TatD family [Prochlorococcus marinus str. MIT 9303] gi|123962431|gb|ABM77187.1| possible deoxyribonuclease, TatD family protein [Prochlorococcus marinus str. MIT 9303] Length = 277 Score = 39.9 bits (92), Expect = 0.10, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 23/39 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 +LI++HCH + +FD+D V R QA V ++ ++ Sbjct: 21 ILIDSHCHIVFRNFDDDLDEVAARWRQAGVASLLHACVE 59 >gi|262380222|ref|ZP_06073377.1| conserved hypothetical protein [Acinetobacter radioresistens SH164] gi|262298416|gb|EEY86330.1| conserved hypothetical protein [Acinetobacter radioresistens SH164] Length = 276 Score = 39.9 bits (92), Expect = 0.10, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 22/35 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF +PDFD DR ++ A A V K++ I Sbjct: 3 LFDTHTHFDVPDFDADREHLAYEAKAAGVEKLVLI 37 >gi|126307051|ref|XP_001374563.1| PREDICTED: similar to TatD DNase domain containing 3 [Monodelphis domestica] Length = 274 Score = 39.9 bits (92), Expect = 0.10, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 24/36 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ++ HCH DF+ D +V+ RA +ANVL ++A+A Sbjct: 8 FVDCHCHLSAADFNSDLEDVLERAKKANVLAIVAVA 43 >gi|163857074|ref|YP_001631372.1| putative deoxyribonuclease [Bordetella petrii DSM 12804] gi|163260802|emb|CAP43104.1| putative Deoxyribonuclease [Bordetella petrii] Length = 268 Score = 39.9 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI+THCH +FD DR V A A V ++ Sbjct: 1 MLIDTHCHLDAAEFDADRLEVASGAWAAGVRSIV 34 >gi|27469210|ref|NP_765847.1| putative deoxyribonuclease [Staphylococcus epidermidis ATCC 12228] gi|57866028|ref|YP_187725.1| TatD family deoxyribonuclease [Staphylococcus epidermidis RP62A] gi|27316759|gb|AAO05934.1|AE016751_229 putative deoxyribonuclease [Staphylococcus epidermidis ATCC 12228] gi|57636686|gb|AAW53474.1| deoxyribonuclease, TatD family [Staphylococcus epidermidis RP62A] gi|319399648|gb|EFV87902.1| hydrolase, TatD family protein [Staphylococcus epidermidis FRI909] gi|329737897|gb|EGG74125.1| hydrolase, TatD family [Staphylococcus epidermidis VCU045] Length = 256 Score = 39.9 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED + VI RA +A V +M + + RT+ L Sbjct: 1 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMFVVGFDTPTIERTMEL 49 >gi|73663574|ref|YP_302355.1| putative deoxyribonuclease [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] gi|72496089|dbj|BAE19410.1| putative deoxyribonuclease [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] Length = 257 Score = 39.9 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED VI RA + V +M + V RT+ L Sbjct: 1 MLIDTHVHLNADQYDEDLEEVIERARENGVDRMFVVGFDTPTVERTMEL 49 >gi|254430874|ref|ZP_05044577.1| DNase, TatD family [Cyanobium sp. PCC 7001] gi|197625327|gb|EDY37886.1| DNase, TatD family [Cyanobium sp. PCC 7001] Length = 289 Score = 39.9 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 24/38 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + +F++D V+ R +A V+ ++ ++ Sbjct: 28 LIDSHCHIVFRNFEDDLDAVVQRWREAGVVGLVHACVE 65 >gi|262404843|ref|ZP_06081397.1| deoxyribonuclease TatD [Vibrio sp. RC586] gi|262348927|gb|EEY98066.1| deoxyribonuclease TatD [Vibrio sp. RC586] Length = 255 Score = 39.9 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA QA + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQAGIEKIL 33 >gi|300114107|ref|YP_003760682.1| TatD family hydrolase [Nitrosococcus watsonii C-113] gi|299540044|gb|ADJ28361.1| hydrolase, TatD family [Nitrosococcus watsonii C-113] Length = 261 Score = 39.9 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Query: 1 MLINTHCHFLLPD---FDEDRHNVIMRAHQANVLKMIAIAIKVI 41 MLI++HCH L D FD H V+ A +A + M+ +++ + Sbjct: 1 MLIDSHCHLNLLDLTPFDGSVHPVMQEARKAGIGHMLCVSVDLE 44 >gi|255320924|ref|ZP_05362098.1| Mg-dependent DNase [Acinetobacter radioresistens SK82] gi|255302093|gb|EET81336.1| Mg-dependent DNase [Acinetobacter radioresistens SK82] Length = 279 Score = 39.9 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 22/35 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF +PDFD DR ++ A A V K++ I Sbjct: 6 LFDTHTHFDVPDFDADREHLAYEAKAAGVEKLVLI 40 >gi|82702510|ref|YP_412076.1| TatD-related deoxyribonuclease [Nitrosospira multiformis ATCC 25196] gi|82410575|gb|ABB74684.1| TatD-related deoxyribonuclease [Nitrosospira multiformis ATCC 25196] Length = 254 Score = 39.9 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 20/41 (48%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH PD ++ R + +V + +++ + Sbjct: 1 MFVDSHCHLDFPDLASRLDELLARMRENDVSHALCVSVNLQ 41 >gi|242241576|ref|ZP_04796021.1| TatD family deoxyribonuclease [Staphylococcus epidermidis W23144] gi|293366133|ref|ZP_06612820.1| TatD family deoxyribonuclease [Staphylococcus epidermidis M23864:W2(grey)] gi|242234957|gb|EES37268.1| TatD family deoxyribonuclease [Staphylococcus epidermidis W23144] gi|291319727|gb|EFE60086.1| TatD family deoxyribonuclease [Staphylococcus epidermidis M23864:W2(grey)] Length = 257 Score = 39.9 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED + VI RA +A V +M + + RT+ L Sbjct: 2 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMFVVGFDTPTIERTMEL 50 >gi|292493125|ref|YP_003528564.1| hydrolase, TatD family [Nitrosococcus halophilus Nc4] gi|291581720|gb|ADE16177.1| hydrolase, TatD family [Nitrosococcus halophilus Nc4] Length = 260 Score = 39.9 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Query: 1 MLINTHCHFLLPD---FDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH L D F H V+ A +A V M+ +++ + Sbjct: 1 MLVDSHCHLNLLDLSPFGGSVHPVVAEAREAGVNHMLCVSVDLE 44 >gi|282875421|ref|ZP_06284293.1| hydrolase, TatD family [Staphylococcus epidermidis SK135] gi|281295778|gb|EFA88300.1| hydrolase, TatD family [Staphylococcus epidermidis SK135] gi|329733024|gb|EGG69363.1| hydrolase, TatD family [Staphylococcus epidermidis VCU028] Length = 256 Score = 39.9 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED + VI RA +A V +M + + RT+ L Sbjct: 1 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMCVVGFDTPTIERTMEL 49 >gi|205372009|ref|ZP_03224827.1| YabD [Bacillus coahuilensis m4-4] Length = 258 Score = 39.9 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H FD D + VI RA ++ V KM+ + Sbjct: 1 MLFDTHVHLNAEQFDSDLNEVIGRAKESGVEKMVVV 36 >gi|329723929|gb|EGG60454.1| hydrolase, TatD family [Staphylococcus epidermidis VCU144] Length = 256 Score = 39.9 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED + VI RA +A V +M + + RT+ L Sbjct: 1 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMFVVGFDTPTIERTMEL 49 >gi|254521539|ref|ZP_05133594.1| deoxyribonuclease, TatD family [Stenotrophomonas sp. SKA14] gi|219719130|gb|EED37655.1| deoxyribonuclease, TatD family [Stenotrophomonas sp. SKA14] Length = 257 Score = 39.9 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 21/38 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 +L+++HCH FD DR VI RA A V + A+ Sbjct: 3 LLVDSHCHLDASAFDRDRAAVIDRARAAGVRLQVVPAV 40 >gi|326387755|ref|ZP_08209361.1| TatD-related deoxyribonuclease [Novosphingobium nitrogenifigens DSM 19370] gi|326207801|gb|EGD58612.1| TatD-related deoxyribonuclease [Novosphingobium nitrogenifigens DSM 19370] Length = 258 Score = 39.9 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI++HCH E + ++ RA + V + I+ + Sbjct: 1 MLIDSHCHLNYKGLIERQGEILARARETGVRGFLNISTR 39 >gi|303237124|ref|ZP_07323694.1| hydrolase, TatD family [Prevotella disiens FB035-09AN] gi|302482511|gb|EFL45536.1| hydrolase, TatD family [Prevotella disiens FB035-09AN] Length = 257 Score = 39.9 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 M+I+TH H +F ED VI RA A V K+ Sbjct: 1 MIIDTHTHLDGEEFKEDLDEVITRAKAAGVSKV 33 >gi|251809799|ref|ZP_04824272.1| TatD family deoxyribonuclease [Staphylococcus epidermidis BCM-HMP0060] gi|251806667|gb|EES59324.1| TatD family deoxyribonuclease [Staphylococcus epidermidis BCM-HMP0060] Length = 257 Score = 39.9 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED + VI RA +A V +M + + RT+ L Sbjct: 2 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMCVVGFDTPTIERTMEL 50 >gi|56961849|ref|YP_173571.1| TatD family deoxyribonuclease [Bacillus clausii KSM-K16] gi|56908083|dbj|BAD62610.1| TatD family deoxyribonuclease [Bacillus clausii KSM-K16] Length = 258 Score = 39.9 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F D I RA +A V +M+ I Sbjct: 1 MLFDTHVHLNAKQFQGDVQETIARAQEAGVKEMVVI 36 >gi|22298730|ref|NP_681977.1| putative Sec-independent protein translocase protein TatD [Thermosynechococcus elongatus BP-1] gi|22294911|dbj|BAC08739.1| tatD [Thermosynechococcus elongatus BP-1] Length = 269 Score = 39.9 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 21/39 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 ML++TH H P++ D V R A V++++ ++ Sbjct: 1 MLVDTHVHLNFPEYAPDLEAVAERWRSAGVVRLVHSCVE 39 >gi|123969222|ref|YP_001010080.1| TatD family deoxyribonuclease [Prochlorococcus marinus str. AS9601] gi|123199332|gb|ABM70973.1| possible deoxyribonuclease, TatD family [Prochlorococcus marinus str. AS9601] Length = 264 Score = 39.9 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 21/36 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI++HCH + +F++D VI+R V K++ Sbjct: 6 LIDSHCHLIFENFEKDLEEVILRLRSRGVKKLVHAC 41 >gi|311693433|gb|ADP96306.1| TatD-related deoxyribonuclease [marine bacterium HP15] Length = 261 Score = 39.6 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 18/38 (47%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI+ HCHF P FD R + + + ++ ++ Sbjct: 3 LIDAHCHFDFPQFDGRRDKELEQGRSRGLRGLVIPGVR 40 >gi|189425297|ref|YP_001952474.1| hydrolase, TatD family [Geobacter lovleyi SZ] gi|189421556|gb|ACD95954.1| hydrolase, TatD family [Geobacter lovleyi SZ] Length = 457 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 19/35 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 +I+THCH DF D ++ RA A V MI + Sbjct: 4 IIDTHCHIYYDDFKLDWDQMLERAETAGVKGMIVV 38 >gi|90581534|ref|ZP_01237327.1| hypothetical protein VAS14_07259 [Vibrio angustum S14] gi|90437296|gb|EAS62494.1| hypothetical protein VAS14_07259 [Vibrio angustum S14] Length = 260 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCHF P F++D +M A + V K++ Sbjct: 1 MIDTHCHFDFPPFNDDPKRALMLAQEGGVKKIV 33 >gi|119944569|ref|YP_942249.1| TatD-related deoxyribonuclease [Psychromonas ingrahamii 37] gi|119863173|gb|ABM02650.1| TatD-related deoxyribonuclease [Psychromonas ingrahamii 37] Length = 267 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 20/38 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I++HCH FD R ++ + Q N+ K+I A Sbjct: 11 MFIDSHCHLNFACFDSQREMLLQQLQQNNITKLIIPAT 48 >gi|119774107|ref|YP_926847.1| TatD-related deoxyribonuclease [Shewanella amazonensis SB2B] gi|119766607|gb|ABL99177.1| TatD-related deoxyribonuclease [Shewanella amazonensis SB2B] Length = 260 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI++H H P+FD DR V +AN+ I Sbjct: 7 LIDSHAHLDFPEFDSDRDAVFAAMSKANISSCI 39 >gi|262163665|ref|ZP_06031406.1| deoxyribonuclease TatD [Vibrio mimicus VM223] gi|262027881|gb|EEY46545.1| deoxyribonuclease TatD [Vibrio mimicus VM223] Length = 255 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA QA + K++ Sbjct: 1 MIDTHAHIYANEFDHDRDEVIARARQAGIEKIL 33 >gi|242371679|ref|ZP_04817253.1| TatD family deoxyribonuclease [Staphylococcus epidermidis M23864:W1] gi|242350628|gb|EES42229.1| TatD family deoxyribonuclease [Staphylococcus epidermidis M23864:W1] Length = 258 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED + VI RA +A V +M + + RT+ L Sbjct: 2 MLIDTHVHLNDEQYDEDLNEVISRAREAGVDRMFVVGFDTPTIERTMEL 50 >gi|167837152|ref|ZP_02464035.1| hydrolase, TatD family protein [Burkholderia thailandensis MSMB43] Length = 262 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH P+FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAPEFDADREVVAAAAQAAGVSRIV 34 >gi|309390029|gb|ADO77909.1| hydrolase, TatD family [Halanaerobium praevalens DSM 2228] Length = 255 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 20/35 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+TH H +++DR V RA Q V K++ I Sbjct: 3 LIDTHAHLDFDHYNKDREKVFERAFQLGVEKIVNI 37 >gi|73748702|ref|YP_307941.1| TatD family hydrolase [Dehalococcoides sp. CBDB1] gi|73660418|emb|CAI83025.1| hydrolase, TatD family [Dehalococcoides sp. CBDB1] Length = 262 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++TH H + +FD DR ++ RA V +I I + Sbjct: 5 VDTHAHLDMAEFDADRSEMLKRACDNGVKTIITTGIDI 42 >gi|258623129|ref|ZP_05718141.1| conserved hypothetical protein [Vibrio mimicus VM573] gi|258584612|gb|EEW09349.1| conserved hypothetical protein [Vibrio mimicus VM573] Length = 255 Score = 39.6 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA QA + K++ Sbjct: 1 MIDTHAHIYANEFDHDRDEVIARARQAGIEKIL 33 >gi|114565625|ref|YP_752779.1| TatD family hydrolase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] gi|114336560|gb|ABI67408.1| hydrolase, TatD family [Syntrophomonas wolfei subsp. wolfei str. Goettingen] Length = 256 Score = 39.6 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 23/36 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H P F++DR ++ RA A + K+I I Sbjct: 1 MLIDTHAHLQDPAFNQDRKEIMQRAKTAGLEKIICI 36 >gi|330447357|ref|ZP_08311006.1| DNase [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] gi|328491548|dbj|GAA05503.1| DNase [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 258 Score = 39.6 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCHF P F +D + A A V +++ Sbjct: 1 MIDTHCHFDFPPFSDDPERALTLAKAAGVKQIV 33 >gi|262172864|ref|ZP_06040542.1| deoxyribonuclease TatD [Vibrio mimicus MB-451] gi|261893940|gb|EEY39926.1| deoxyribonuclease TatD [Vibrio mimicus MB-451] Length = 255 Score = 39.6 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA QA + K++ Sbjct: 1 MIDTHAHIYANEFDHDRDEVIARARQAGIEKIL 33 >gi|258626619|ref|ZP_05721449.1| conserved hypothetical protein [Vibrio mimicus VM603] gi|258581123|gb|EEW06042.1| conserved hypothetical protein [Vibrio mimicus VM603] Length = 255 Score = 39.6 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA QA + K++ Sbjct: 1 MIDTHAHIYANEFDHDRDEVIARARQAGIEKIL 33 >gi|301308383|ref|ZP_07214337.1| hydrolase, TatD family [Bacteroides sp. 20_3] gi|300833853|gb|EFK64469.1| hydrolase, TatD family [Bacteroides sp. 20_3] Length = 261 Score = 39.6 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+THCH L DFD ++ + +A + + ++ Sbjct: 3 LIDTHCHLYLEDFDPEQDELAQKAKDSGIDTLL 35 >gi|158321681|ref|YP_001514188.1| TatD family hydrolase [Alkaliphilus oremlandii OhILAs] gi|158141880|gb|ABW20192.1| hydrolase, TatD family [Alkaliphilus oremlandii OhILAs] Length = 255 Score = 39.6 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+ ++H H FD +R +I RA ++ + ++ Sbjct: 1 MIFDSHAHLDDERFDGERDQIIARAKESGIELIL 34 >gi|228470070|ref|ZP_04054979.1| hydrolase, TatD family [Porphyromonas uenonis 60-3] gi|228308208|gb|EEK17063.1| hydrolase, TatD family [Porphyromonas uenonis 60-3] Length = 263 Score = 39.6 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI+TH H +++ DR VI AH+A V ++ Sbjct: 1 MLIDTHTHIYGTEYEADRDAVISAAHEAGVGYLV 34 >gi|288932626|ref|YP_003436686.1| hydrolase, TatD family [Ferroglobus placidus DSM 10642] gi|288894874|gb|ADC66411.1| hydrolase, TatD family [Ferroglobus placidus DSM 10642] Length = 247 Score = 39.6 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L++ HCH +F+ DR VI+RA + V+ +I Sbjct: 4 LVDIHCHIDFSNFNGDRKEVILRALREGVISII 36 >gi|33862042|ref|NP_893603.1| TatD family deoxyribonuclease [Prochlorococcus marinus subsp. pastoris str. CCMP1986] gi|33634260|emb|CAE19945.1| possible deoxyribonuclease, TatD family [Prochlorococcus marinus subsp. pastoris str. CCMP1986] Length = 264 Score = 39.6 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 20/36 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI++HCH + +F+ED V+ R V K++ Sbjct: 6 LIDSHCHLIFENFEEDLEEVVSRWRSIGVKKLLHAC 41 >gi|294340174|emb|CAZ88546.1| putative Mg-dependent DNase, TatD [Thiomonas sp. 3As] Length = 260 Score = 39.6 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 19/40 (47%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 L ++HCH P +E +V+ H+ V + + I + Sbjct: 5 LTDSHCHLAYPGLEERLDDVLAHMHEKGVTRALNICTTLE 44 >gi|289674951|ref|ZP_06495841.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. syringae FF5] Length = 197 Score = 39.6 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ V +M+ + + Sbjct: 5 LIDTHTHLDFADFDADRAQVLDNCLALGVQRMVVLGV 41 >gi|327395207|dbj|BAK12629.1| putative deoxyribonuclease YjjV [Pantoea ananatis AJ13355] Length = 257 Score = 39.6 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 21/41 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++THCHF P F + RA Q+ V K+I ++ R Sbjct: 3 FVDTHCHFDFPPFVGQAEESLARAAQSGVEKIIVPSVDAGR 43 >gi|311107115|ref|YP_003979968.1| TatD related DNAse family protein [Achromobacter xylosoxidans A8] gi|310761804|gb|ADP17253.1| TatD related DNAse family protein [Achromobacter xylosoxidans A8] Length = 272 Score = 39.6 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI+THCH +FD DR V A +A+V ++ Sbjct: 1 MLIDTHCHLDAAEFDADREQVADDACEASVQSIV 34 >gi|171914378|ref|ZP_02929848.1| hydrolase, TatD family protein [Verrucomicrobium spinosum DSM 4136] Length = 263 Score = 39.2 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 19/41 (46%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML +TH H F D +I RA A V ++I I + Sbjct: 1 MLTDTHAHLASRQFANDLPEIIERARAAGVKRIICIGTTLE 41 >gi|126697015|ref|YP_001091901.1| TatD family deoxyribonuclease [Prochlorococcus marinus str. MIT 9301] gi|126544058|gb|ABO18300.1| possible deoxyribonuclease, TatD family [Prochlorococcus marinus str. MIT 9301] Length = 264 Score = 39.2 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 10/36 (27%), Positives = 20/36 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI++HCH + +F+ D +V+ R + K++ Sbjct: 6 LIDSHCHLIFENFERDLEDVVSRLRSKGIKKLVHAC 41 >gi|85712639|ref|ZP_01043685.1| Mg-dependent DNase-like protein [Idiomarina baltica OS145] gi|85693489|gb|EAQ31441.1| Mg-dependent DNase-like protein [Idiomarina baltica OS145] Length = 257 Score = 39.2 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCH FD+DR V+ A + V + + + I Sbjct: 3 LYDTHCHLDFSAFDKDRSQVVAGAQRVGVERFMLLGI 39 >gi|307565040|ref|ZP_07627553.1| hydrolase, TatD family [Prevotella amnii CRIS 21A-A] gi|307346209|gb|EFN91533.1| hydrolase, TatD family [Prevotella amnii CRIS 21A-A] Length = 269 Score = 39.2 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 23/38 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M+I+TH H + D+ ED VI RA +A V K+ +I Sbjct: 1 MIIDTHAHLDVDDYKEDLPEVISRAKKAGVDKIFIPSI 38 >gi|255012433|ref|ZP_05284559.1| putative deoxyribonuclease [Bacteroides sp. 2_1_7] gi|256839152|ref|ZP_05544662.1| conserved hypothetical protein [Parabacteroides sp. D13] gi|298374698|ref|ZP_06984656.1| hydrolase, TatD family [Bacteroides sp. 3_1_19] gi|256740071|gb|EEU53395.1| conserved hypothetical protein [Parabacteroides sp. D13] gi|298269066|gb|EFI10721.1| hydrolase, TatD family [Bacteroides sp. 3_1_19] Length = 261 Score = 39.2 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+THCH L DFD ++ + +A + + ++ Sbjct: 3 LIDTHCHLYLEDFDPEQDELAQKAKDSGIDTLL 35 >gi|167753800|ref|ZP_02425927.1| hypothetical protein ALIPUT_02085 [Alistipes putredinis DSM 17216] gi|167658425|gb|EDS02555.1| hypothetical protein ALIPUT_02085 [Alistipes putredinis DSM 17216] Length = 287 Score = 39.2 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+TH H +FD DR I RA +A V +++ Sbjct: 4 LIDTHSHIYAEEFDADRDEAIRRAREAGVERLL 36 >gi|120555384|ref|YP_959735.1| TatD-related deoxyribonuclease [Marinobacter aquaeolei VT8] gi|120325233|gb|ABM19548.1| TatD-related deoxyribonuclease [Marinobacter aquaeolei VT8] Length = 263 Score = 39.2 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 L++ HCHF P FD R V+ +A V ++ ++ Sbjct: 3 LVDAHCHFDFPFFDGHRETVLAQAASLGVCAIVIPGVR 40 >gi|253987974|ref|YP_003039330.1| hypothetical protein PAU_00493 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] gi|253779424|emb|CAQ82585.1| conserved hypothetical protein [Photorhabdus asymbiotica] Length = 257 Score = 39.2 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCHF P F +D + +A Q V K+I A+ Sbjct: 1 MFIDTHCHFDFPPFCDDERQSLQQAAQVGVDKIIVPAV 38 >gi|226309674|ref|YP_002769568.1| deoxyribonuclease [Brevibacillus brevis NBRC 100599] gi|226092622|dbj|BAH41064.1| putative deoxyribonuclease [Brevibacillus brevis NBRC 100599] Length = 256 Score = 39.2 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 20/36 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML TH H +FDEDR VI RA + V ++ I Sbjct: 1 MLFETHAHLNANEFDEDRAEVIARAQENGVSTIVNI 36 >gi|262382414|ref|ZP_06075551.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B] gi|262295292|gb|EEY83223.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B] Length = 261 Score = 39.2 bits (90), Expect = 0.18, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+THCH L DFD ++ + +A + + ++ Sbjct: 3 LIDTHCHLYLEDFDPEQDELAQKAKDSGIDTLL 35 >gi|150010301|ref|YP_001305044.1| putative deoxyribonuclease [Parabacteroides distasonis ATCC 8503] gi|149938725|gb|ABR45422.1| putative deoxyribonuclease [Parabacteroides distasonis ATCC 8503] Length = 261 Score = 39.2 bits (90), Expect = 0.18, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+THCH L DFD ++ + +A + + ++ Sbjct: 3 LIDTHCHLYLEDFDPEQDELAQKAKDSGIDTLL 35 >gi|87199955|ref|YP_497212.1| TatD-related deoxyribonuclease [Novosphingobium aromaticivorans DSM 12444] gi|87135636|gb|ABD26378.1| TatD-related deoxyribonuclease [Novosphingobium aromaticivorans DSM 12444] Length = 259 Score = 39.2 bits (90), Expect = 0.18, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 21/39 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI++HCH ED+ V+ RA + V + I+ + Sbjct: 2 MLIDSHCHLNYKGLVEDQRQVLDRARENGVRGFLNISTR 40 >gi|224436938|ref|ZP_03657919.1| hypothetical protein HcinC1_03150 [Helicobacter cinaedi CCUG 18818] gi|313143410|ref|ZP_07805603.1| hydrolase [Helicobacter cinaedi CCUG 18818] gi|313128441|gb|EFR46058.1| hydrolase [Helicobacter cinaedi CCUG 18818] Length = 263 Score = 39.2 bits (90), Expect = 0.18, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCH FDED +VI RA NV K+I Sbjct: 1 MIDTHCHLDSTRFDEDLDSVIQRAFSHNVKKII 33 >gi|224823507|ref|ZP_03696616.1| TatD-related deoxyribonuclease [Lutiella nitroferrum 2002] gi|224603962|gb|EEG10136.1| TatD-related deoxyribonuclease [Lutiella nitroferrum 2002] Length = 261 Score = 39.2 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH +FD R V+ A + +++ A+ Sbjct: 11 LIDSHCHLDAAEFDGVRDEVVAEAVGLGIGQILVPAV 47 >gi|113867195|ref|YP_725684.1| Mg-dependent DNase [Ralstonia eutropha H16] gi|113525971|emb|CAJ92316.1| Mg-dependent DNase [Ralstonia eutropha H16] Length = 279 Score = 39.2 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 20/38 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V A A V ++ A+ Sbjct: 1 MWIDTHCHLDASEFDADRQQVADAAEAAGVRGIVVPAV 38 >gi|328953086|ref|YP_004370420.1| hydrolase, TatD family [Desulfobacca acetoxidans DSM 11109] gi|328453410|gb|AEB09239.1| hydrolase, TatD family [Desulfobacca acetoxidans DSM 11109] Length = 263 Score = 39.2 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 23/40 (57%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 ++H H +P+F +D+ +I +A A V MI + I + + Sbjct: 8 DSHTHLDMPEFADDQEQIIEQARVAGVELMINVGISLDNS 47 >gi|32266821|ref|NP_860853.1| hypothetical protein HH1322 [Helicobacter hepaticus ATCC 51449] gi|32262873|gb|AAP77919.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449] Length = 265 Score = 39.2 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++THCH F+ D VI RA++ NV K+I Sbjct: 8 MVDTHCHLDSQSFENDLEQVIARAYEQNVAKII 40 >gi|156740268|ref|YP_001430397.1| TatD family hydrolase [Roseiflexus castenholzii DSM 13941] gi|156231596|gb|ABU56379.1| hydrolase, TatD family [Roseiflexus castenholzii DSM 13941] Length = 258 Score = 39.2 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 19/35 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+TH H FD DR V+ RA V +++ I Sbjct: 7 LIDTHAHLGAAQFDADRTAVLERARATGVARIVEI 41 >gi|291533509|emb|CBL06622.1| Mg-dependent DNase [Megamonas hypermegale ART12/1] Length = 105 Score = 39.2 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTL 44 ML++TH H ++EDR VI RA ++I + + + Sbjct: 1 MLVDTHAHLDDLKYEEDRQEVIARAKAEGTTRIITMGDTMESSF 44 >gi|220933025|ref|YP_002509933.1| hydrolase, TatD family [Halothermothrix orenii H 168] gi|219994335|gb|ACL70938.1| hydrolase, TatD family [Halothermothrix orenii H 168] Length = 257 Score = 39.2 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 20/35 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+TH H P F +DR VI RA + V +I + Sbjct: 3 LIDTHAHLDFPRFKKDRVKVIKRAEEDGVKYIINV 37 >gi|329903718|ref|ZP_08273594.1| Putative deoxyribonuclease YjjV [Oxalobacteraceae bacterium IMCC9480] gi|327548239|gb|EGF32938.1| Putative deoxyribonuclease YjjV [Oxalobacteraceae bacterium IMCC9480] Length = 265 Score = 39.2 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 20/38 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +F + V A +A V +++ AI Sbjct: 1 MWIDTHCHLDAAEFAGEHEAVASDAQRAGVSRIVIPAI 38 >gi|223044419|ref|ZP_03614452.1| hydrolase, TatD family [Staphylococcus capitis SK14] gi|222442208|gb|EEE48320.1| hydrolase, TatD family [Staphylococcus capitis SK14] Length = 257 Score = 39.2 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED + VI RA +A V +M + + RT+ L Sbjct: 2 MLIDTHVHLNDEQYDEDLNEVISRAQEAGVDRMFVVGFDTPTIERTMEL 50 >gi|108760274|ref|YP_630215.1| TatD family hydrolase [Myxococcus xanthus DK 1622] gi|108464154|gb|ABF89339.1| hydrolase, TatD family [Myxococcus xanthus DK 1622] Length = 265 Score = 39.2 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCH FD DR+ V+ RA A + ++ Sbjct: 1 MIDTHCHLDASRFDADRNEVLSRAWAAGLHGIV 33 >gi|269926125|ref|YP_003322748.1| hydrolase, TatD family [Thermobaculum terrenum ATCC BAA-798] gi|269789785|gb|ACZ41926.1| hydrolase, TatD family [Thermobaculum terrenum ATCC BAA-798] Length = 258 Score = 39.2 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ML+++H H FDEDR VI+RA + + ++ + Sbjct: 1 MLVDSHAHINSTAFDEDREQVIVRAFEQGIRLILDVGT 38 >gi|330941571|gb|EGH44356.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. pisi str. 1704B] Length = 169 Score = 39.2 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ V +M+ + + Sbjct: 5 LIDTHTHLDFADFDADRAQVLDNCLALGVQRMVVLGV 41 >gi|294634641|ref|ZP_06713175.1| hydrogenase nickel insertion protein HypA [Edwardsiella tarda ATCC 23685] gi|291091971|gb|EFE24532.1| hydrogenase nickel insertion protein HypA [Edwardsiella tarda ATCC 23685] Length = 263 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 20/41 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 LI+THCHF F D + RA A V +I ++ R Sbjct: 6 LIDTHCHFDFAPFCGDVSASLQRARAAGVQAIIVPSVAADR 46 >gi|228476218|ref|ZP_04060921.1| hydrolase, TatD family [Staphylococcus hominis SK119] gi|314937302|ref|ZP_07844644.1| deoxyribonuclease, TatD family [Staphylococcus hominis subsp. hominis C80] gi|228269703|gb|EEK11202.1| hydrolase, TatD family [Staphylococcus hominis SK119] gi|313654598|gb|EFS18348.1| deoxyribonuclease, TatD family [Staphylococcus hominis subsp. hominis C80] Length = 256 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED VI RA +A V +M + + RT+ L Sbjct: 1 MLIDTHVHLNDEQYDEDLSEVISRAREAGVDRMFVVGFDTKTIERTMEL 49 >gi|314932713|ref|ZP_07840083.1| deoxyribonuclease, TatD family [Staphylococcus caprae C87] gi|313654543|gb|EFS18295.1| deoxyribonuclease, TatD family [Staphylococcus caprae C87] Length = 256 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED + VI RA +A V +M + + RT+ L Sbjct: 1 MLIDTHVHLNDEQYDEDLNEVISRAQEAGVDRMFVVGFDTPTIERTMEL 49 >gi|149919183|ref|ZP_01907666.1| deoxyribonuclease, TatD family protein [Plesiocystis pacifica SIR-1] gi|149819897|gb|EDM79319.1| deoxyribonuclease, TatD family protein [Plesiocystis pacifica SIR-1] Length = 280 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 17/35 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI++HCH +D RA A V +M+ I Sbjct: 17 LIDSHCHLDYAPMADDLEATFARAEAAGVEQMVHI 51 >gi|159904149|ref|YP_001551493.1| TatD family deoxyribonuclease [Prochlorococcus marinus str. MIT 9211] gi|159889325|gb|ABX09539.1| possible deoxyribonuclease, TatD family [Prochlorococcus marinus str. MIT 9211] Length = 261 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 21/39 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 +LI++HCH + +F+ED + R V ++ ++ Sbjct: 5 VLIDSHCHLIFKNFEEDLDEIAERWRAVGVQSLVHACVE 43 >gi|307299340|ref|ZP_07579141.1| hydrolase, TatD family [Thermotogales bacterium mesG1.Ag.4.2] gi|306915136|gb|EFN45522.1| hydrolase, TatD family [Thermotogales bacterium mesG1.Ag.4.2] Length = 270 Score = 39.2 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 19/39 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 L++TH H P FD DR VI + V ++ I V Sbjct: 18 LVDTHAHISFPQFDSDRDRVIRQIEDEEVSLLVEIGTNV 56 >gi|310820062|ref|YP_003952420.1| hydrolase, tatd family [Stigmatella aurantiaca DW4/3-1] gi|309393134|gb|ADO70593.1| Hydrolase, TatD family [Stigmatella aurantiaca DW4/3-1] Length = 265 Score = 39.2 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCH FD DR +V+ RA A + ++ Sbjct: 1 MIDTHCHLDASRFDPDRSDVLTRAWAAGLQGIV 33 >gi|241766830|ref|ZP_04764650.1| TatD-related deoxyribonuclease [Acidovorax delafieldii 2AN] gi|241362769|gb|EER58551.1| TatD-related deoxyribonuclease [Acidovorax delafieldii 2AN] Length = 276 Score = 39.2 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 15/29 (51%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVL 31 I+THCH +F DR V RA A V Sbjct: 5 IDTHCHLDAAEFAPDRDAVRQRAAAAGVA 33 >gi|303241036|ref|ZP_07327546.1| hydrolase, TatD family [Acetivibrio cellulolyticus CD2] gi|302591461|gb|EFL61199.1| hydrolase, TatD family [Acetivibrio cellulolyticus CD2] Length = 259 Score = 38.8 bits (89), Expect = 0.22, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 23/41 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML +TH H+ F EDR +VI +AH + V +I + + Sbjct: 1 MLFDTHAHYDDEKFIEDRFDVIEKAHSSGVSYIINASTDIK 41 >gi|258647196|ref|ZP_05734665.1| deoxyribonuclease, TatD family [Prevotella tannerae ATCC 51259] gi|260853025|gb|EEX72894.1| deoxyribonuclease, TatD family [Prevotella tannerae ATCC 51259] Length = 260 Score = 38.8 bits (89), Expect = 0.22, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+TH H +FD DR +VI RA A ++I Sbjct: 1 MFIDTHAHLYGEEFDADRDDVIRRALAAGAEQII 34 >gi|253730958|ref|ZP_04865123.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus USA300_TCH959] gi|253725308|gb|EES94037.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus USA300_TCH959] Length = 257 Score = 38.8 bits (89), Expect = 0.22, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +D+D VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDDDLSEVITRAREAGVNRMFVV 36 >gi|147676405|ref|YP_001210620.1| Mg-dependent DNase [Pelotomaculum thermopropionicum SI] gi|146272502|dbj|BAF58251.1| Mg-dependent DNase [Pelotomaculum thermopropionicum SI] Length = 256 Score = 38.8 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 20/36 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 +L +TH H F+ DR V+ RA +A V ++ + Sbjct: 2 VLFDTHAHLDDRSFEADREEVVRRAREAGVSCIVNV 37 >gi|87301295|ref|ZP_01084136.1| possible deoxyribonuclease [Synechococcus sp. WH 5701] gi|87284263|gb|EAQ76216.1| possible deoxyribonuclease [Synechococcus sp. WH 5701] Length = 279 Score = 38.8 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 L+++HCH + F+ D V R +A V+ ++ ++ Sbjct: 16 LVDSHCHVVFSTFEADLDAVAERWREAGVVSLLHACVE 53 >gi|23097502|ref|NP_690968.1| hypothetical protein OB0047 [Oceanobacillus iheyensis HTE831] gi|22775725|dbj|BAC12003.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 256 Score = 38.8 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F +DR I RA+ A V M+ + Sbjct: 1 MLFDTHVHLNARQFKDDREETIQRAYDAGVENMVVV 36 >gi|282915809|ref|ZP_06323577.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus D139] gi|283768926|ref|ZP_06341835.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus H19] gi|282320300|gb|EFB50642.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus D139] gi|283461107|gb|EFC08193.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus H19] Length = 257 Score = 38.8 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +D+D VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDDDLSEVITRAREAGVDRMFVV 36 >gi|15612546|ref|NP_224199.1| hypothetical protein jhp1481 [Helicobacter pylori J99] gi|4156101|gb|AAD07053.1| putative [Helicobacter pylori J99] Length = 254 Score = 38.8 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLDEVLKESLEKGVTQCV 34 >gi|89256652|ref|YP_514014.1| TatD related DNAse family protein [Francisella tularensis subsp. holarctica LVS] gi|115315065|ref|YP_763788.1| TatD family deoxyribonuclease [Francisella tularensis subsp. holarctica OSU18] gi|156502795|ref|YP_001428860.1| TatD hydrolase family protein [Francisella tularensis subsp. holarctica FTNF002-00] gi|167010540|ref|ZP_02275471.1| TatD related DNAse family protein [Francisella tularensis subsp. holarctica FSC200] gi|254367964|ref|ZP_04983984.1| tatD related DNAse family protein [Francisella tularensis subsp. holarctica 257] gi|290953409|ref|ZP_06558030.1| TatD hydrolase family protein [Francisella tularensis subsp. holarctica URFT1] gi|295313370|ref|ZP_06803979.1| TatD hydrolase family protein [Francisella tularensis subsp. holarctica URFT1] gi|89144483|emb|CAJ79790.1| TatD related DNAse family protein [Francisella tularensis subsp. holarctica LVS] gi|115129964|gb|ABI83151.1| TatD family deoxyribonuclease [Francisella tularensis subsp. holarctica OSU18] gi|134253774|gb|EBA52868.1| tatD related DNAse family protein [Francisella tularensis subsp. holarctica 257] gi|156253398|gb|ABU61904.1| TatD hydrolase family protein [Francisella tularensis subsp. holarctica FTNF002-00] Length = 224 Score = 38.8 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R N++ ++ V I A + Sbjct: 1 MFIDTHCHLDFDIFDKTRQNILQNCNKLGVNYFINPATQ 39 >gi|261886478|ref|ZP_06010517.1| YabD [Campylobacter fetus subsp. venerealis str. Azul-94] Length = 106 Score = 38.8 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+THCH +DED V+ A + + K+I Sbjct: 1 MIIDTHCHLDDERYDEDLDAVLENAFKNGIKKLI 34 >gi|224367803|ref|YP_002601966.1| TatD1 [Desulfobacterium autotrophicum HRM2] gi|223690519|gb|ACN13802.1| TatD1 [Desulfobacterium autotrophicum HRM2] Length = 264 Score = 38.8 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 23/42 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 L ++HCH P F+ED ++ RA +A V M+ + + + Sbjct: 3 LFDSHCHINDPCFEEDFDPMLERASEAGVKAMMIAGVSIETS 44 >gi|169797213|ref|YP_001715006.1| hypothetical protein ABAYE3229 [Acinetobacter baumannii AYE] gi|213155994|ref|YP_002318039.1| hydrolase, TatD family [Acinetobacter baumannii AB0057] gi|215484654|ref|YP_002326889.1| Putative deoxyribonuclease yjjV [Acinetobacter baumannii AB307-0294] gi|294836300|ref|ZP_06780983.1| Putative deoxyribonuclease yjjV [Acinetobacter sp. 6013113] gi|294857760|ref|ZP_06795529.1| Putative deoxyribonuclease yjjV [Acinetobacter sp. 6013150] gi|301346808|ref|ZP_07227549.1| Putative deoxyribonuclease yjjV [Acinetobacter baumannii AB056] gi|301510093|ref|ZP_07235330.1| Putative deoxyribonuclease yjjV [Acinetobacter baumannii AB058] gi|301594651|ref|ZP_07239659.1| Putative deoxyribonuclease yjjV [Acinetobacter baumannii AB059] gi|169150140|emb|CAM88034.1| conserved hypothetical protein [Acinetobacter baumannii AYE] gi|213055154|gb|ACJ40056.1| hydrolase, TatD family [Acinetobacter baumannii AB0057] gi|213988370|gb|ACJ58669.1| Putative deoxyribonuclease yjjV [Acinetobacter baumannii AB307-0294] Length = 270 Score = 38.8 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFDEDRH + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRHQLALEAKKVGVNALVLI 37 >gi|33241090|ref|NP_876032.1| putative deoxyribonuclease, TatD family [Prochlorococcus marinus subsp. marinus str. CCMP1375] gi|33238619|gb|AAQ00685.1| Mg-dependent DNase [Prochlorococcus marinus subsp. marinus str. CCMP1375] Length = 262 Score = 38.8 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + P+F++D V R V ++ ++ Sbjct: 6 LIDSHCHIVFPNFEDDLEEVAARWRAVGVKSLLHACVE 43 >gi|256822031|ref|YP_003145994.1| TatD-like deoxyribonuclease [Kangiella koreensis DSM 16069] gi|256795570|gb|ACV26226.1| TatD-related deoxyribonuclease [Kangiella koreensis DSM 16069] Length = 265 Score = 38.8 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANV 30 L ++HCH P FD+DR ++ H+ + Sbjct: 13 LFDSHCHLDFPVFDKDREVILSNLHKVGI 41 >gi|254457998|ref|ZP_05071425.1| Mg2+ dependent DNAse [Campylobacterales bacterium GD 1] gi|207085391|gb|EDZ62676.1| Mg2+ dependent DNAse [Campylobacterales bacterium GD 1] Length = 258 Score = 38.8 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+TH H P +++D +V+ RA + V + I Sbjct: 1 MIIDTHIHLDDPRYNDDIDDVLNRAREGGVKRFI 34 >gi|222152164|ref|YP_002561324.1| hypothetical protein MCCL_1921 [Macrococcus caseolyticus JCSC5402] gi|222121293|dbj|BAH18628.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402] Length = 258 Score = 38.8 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA---IKVIRTLFL 46 MLI+TH H +DED VI RA + + +MI + + RT+ L Sbjct: 1 MLIDTHVHLNADQYDEDLQEVIDRARENGIDRMIVVGFDEKTIKRTMKL 49 >gi|167856678|ref|ZP_02479366.1| hypothetical protein HPS_11553 [Haemophilus parasuis 29755] gi|167852200|gb|EDS23526.1| hypothetical protein HPS_11553 [Haemophilus parasuis 29755] Length = 281 Score = 38.8 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAIKVIR 42 +I++HCH D++ VI A V +MI+I + R Sbjct: 27 IIDSHCHLDSLDYETRHKNVDEVIDNAKARGVQQMISICTTLGR 70 >gi|220934995|ref|YP_002513894.1| TatD-related deoxyribonuclease [Thioalkalivibrio sp. HL-EbGR7] gi|219996305|gb|ACL72907.1| TatD-related deoxyribonuclease [Thioalkalivibrio sp. HL-EbGR7] Length = 259 Score = 38.8 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Query: 1 MLINTHCHFLLPD---FDEDRHNVIMRAHQANVLKMIAIAIKVI 41 MLI++HCH D FD V+ A A V M+ ++I + Sbjct: 1 MLIDSHCHLDRIDLEPFDGSLDKVMDSARAAGVGHMLCVSISLE 44 >gi|33863775|ref|NP_895335.1| TatD family deoxyribonuclease [Prochlorococcus marinus str. MIT 9313] gi|33635358|emb|CAE21683.1| possible deoxyribonuclease, TatD family [Prochlorococcus marinus str. MIT 9313] Length = 277 Score = 38.8 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 22/39 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 + I++HCH + +FD+D V R QA V ++ ++ Sbjct: 21 IFIDSHCHIVFRNFDDDLDEVAERWRQAGVASLLHACVE 59 >gi|317968940|ref|ZP_07970330.1| Mg-dependent DNase [Synechococcus sp. CB0205] Length = 273 Score = 38.8 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + +FDED V R A V +++ ++ Sbjct: 14 LIDSHCHIVFRNFDEDLEEVAQRWRDAGVGRLLHACVE 51 >gi|254372695|ref|ZP_04988184.1| TatD family deoxyribonuclease [Francisella tularensis subsp. novicida GA99-3549] gi|151570422|gb|EDN36076.1| TatD family deoxyribonuclease [Francisella novicida GA99-3549] Length = 248 Score = 38.8 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R N++ ++ V I A + Sbjct: 1 MFIDTHCHLDFDIFDKTRQNILQNCNKLGVNYFINPATQ 39 >gi|317015010|gb|ADU82446.1| hypothetical protein HPGAM_08410 [Helicobacter pylori Gambia94/24] Length = 254 Score = 38.8 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLDEVLKESLEKGVTQCV 34 >gi|218291060|ref|ZP_03495092.1| hydrolase, TatD family [Alicyclobacillus acidocaldarius LAA1] gi|218239014|gb|EED06220.1| hydrolase, TatD family [Alicyclobacillus acidocaldarius LAA1] Length = 259 Score = 38.8 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCH + F +D +V+ RA +A V +M+ A+ Sbjct: 3 LFDTHCHLMDRRFADDLDDVLARAREAGVERMVVPAV 39 >gi|261339028|ref|ZP_05966886.1| hypothetical protein ENTCAN_05237 [Enterobacter cancerogenus ATCC 35316] gi|288318863|gb|EFC57801.1| hydrogenase nickel insertion protein HypA [Enterobacter cancerogenus ATCC 35316] Length = 260 Score = 38.8 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 18/38 (47%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + I RA QA V +I AI+ Sbjct: 5 FIDTHCHFDFPPFTGDETHSIARAAQAGVGAIIVPAIE 42 >gi|187931537|ref|YP_001891521.1| Mg-dependent DNase [Francisella tularensis subsp. mediasiatica FSC147] gi|187712446|gb|ACD30743.1| Mg-dependent DNase [Francisella tularensis subsp. mediasiatica FSC147] Length = 248 Score = 38.8 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R N++ ++ V I A + Sbjct: 1 MFIDTHCHLDFDIFDKTRQNILQNCNKLGVNYFINPATQ 39 >gi|54113681|gb|AAV29474.1| NT02FT0924 [synthetic construct] Length = 248 Score = 38.8 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R N++ ++ V I A + Sbjct: 1 MFIDTHCHLDFDIFDKTRQNILQNCNKLGVNYFINPATQ 39 >gi|56707877|ref|YP_169773.1| TatD related DNAse family protein [Francisella tularensis subsp. tularensis SCHU S4] gi|110670348|ref|YP_666905.1| TatD related DNAse family protein [Francisella tularensis subsp. tularensis FSC198] gi|134301719|ref|YP_001121687.1| tatD family hydrolase [Francisella tularensis subsp. tularensis WY96-3418] gi|254370370|ref|ZP_04986375.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC033] gi|56604369|emb|CAG45396.1| TatD related DNAse family protein [Francisella tularensis subsp. tularensis SCHU S4] gi|110320681|emb|CAL08779.1| TatD related DNAse family protein [Francisella tularensis subsp. tularensis FSC198] gi|134049496|gb|ABO46567.1| tatD family hydrolase [Francisella tularensis subsp. tularensis WY96-3418] gi|151568613|gb|EDN34267.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC033] gi|282159060|gb|ADA78451.1| tatD family hydrolase [Francisella tularensis subsp. tularensis NE061598] Length = 248 Score = 38.8 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R N++ ++ V I A + Sbjct: 1 MFIDTHCHLDFDIFDKTRQNILQNCNKLGVNYFINPATQ 39 >gi|312897477|ref|ZP_07756901.1| hydrolase, TatD family [Megasphaera micronuciformis F0359] gi|310621538|gb|EFQ05074.1| hydrolase, TatD family [Megasphaera micronuciformis F0359] Length = 255 Score = 38.8 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 21/40 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML +THCH + +DR ++ RA +A V M+ V Sbjct: 1 MLFDTHCHINDEAYKDDRAEMMARAFEAGVGCMVCPGTGV 40 >gi|82750198|ref|YP_415939.1| sec-independent hydrolase [Staphylococcus aureus RF122] gi|82655729|emb|CAI80128.1| probable sec-independent hydrolase [Staphylococcus aureus RF122] Length = 257 Score = 38.8 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +D+D VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDDDLSEVITRAREAGVDRMFVV 36 >gi|88807331|ref|ZP_01122843.1| TatD-related deoxyribonuclease [Synechococcus sp. WH 7805] gi|88788545|gb|EAR19700.1| TatD-related deoxyribonuclease [Synechococcus sp. WH 7805] Length = 271 Score = 38.8 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + +FDED V R A V ++ ++ Sbjct: 16 LIDSHCHIVFRNFDEDLDAVAERWRNAGVASLLHACVE 53 >gi|114570002|ref|YP_756682.1| Sec-independent protein translocase TatD [Maricaulis maris MCS10] gi|114340464|gb|ABI65744.1| Sec-independent protein translocase TatD [Maricaulis maris MCS10] Length = 260 Score = 38.8 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 21/40 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M +++H + F ED VI RA A V +MI I ++ Sbjct: 1 MWVDSHVNLHGEQFAEDLDQVIDRARAAGVGRMITICCRL 40 >gi|296131645|ref|YP_003638892.1| hydrolase, TatD family [Thermincola sp. JR] gi|296030223|gb|ADG80991.1| hydrolase, TatD family [Thermincola potens JR] Length = 258 Score = 38.8 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 22/36 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+ H H +++DRH ++MRA + V ++ + Sbjct: 1 MLIDAHAHLDDSKYEQDRHEMLMRAKERGVTHIVNV 36 >gi|288554647|ref|YP_003426582.1| metal-dependent DNA hydrolase of TatD family [Bacillus pseudofirmus OF4] gi|288545807|gb|ADC49690.1| Metal-dependent DNA hydrolase of TatD family [Bacillus pseudofirmus OF4] Length = 256 Score = 38.8 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F++D VI RA +A V +M+ + Sbjct: 1 MLFDTHVHLNADQFEDDVEEVINRAKEAGVSEMVVV 36 >gi|258424474|ref|ZP_05687353.1| conserved hypothetical protein [Staphylococcus aureus A9635] gi|257845343|gb|EEV69378.1| conserved hypothetical protein [Staphylococcus aureus A9635] Length = 257 Score = 38.4 bits (88), Expect = 0.29, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +D+D VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDDDLSEVITRAREAGVDRMFVV 36 >gi|323442065|gb|EGA99700.1| sec-independent hydrolase [Staphylococcus aureus O46] Length = 257 Score = 38.4 bits (88), Expect = 0.29, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +D+D VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDDDLSEVITRAREAGVDRMFVV 36 >gi|163849127|ref|YP_001637171.1| TatD family hydrolase [Chloroflexus aurantiacus J-10-fl] gi|222527099|ref|YP_002571570.1| hydrolase, TatD family [Chloroflexus sp. Y-400-fl] gi|163670416|gb|ABY36782.1| hydrolase, TatD family [Chloroflexus aurantiacus J-10-fl] gi|222450978|gb|ACM55244.1| hydrolase, TatD family [Chloroflexus sp. Y-400-fl] Length = 263 Score = 38.4 bits (88), Expect = 0.29, Method: Composition-based stats. Identities = 18/35 (51%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+TH H F+EDR VI+RA A V MI I Sbjct: 7 LIDTHLHLASEQFNEDRSAVILRAIDAGVAAMIEI 41 >gi|15923481|ref|NP_371015.1| putative deoxyribonuclease [Staphylococcus aureus subsp. aureus Mu50] gi|15926168|ref|NP_373701.1| hypothetical protein SA0449 [Staphylococcus aureus subsp. aureus N315] gi|21282175|ref|NP_645263.1| hypothetical protein MW0446 [Staphylococcus aureus subsp. aureus MW2] gi|49482718|ref|YP_039942.1| TatD related DNase [Staphylococcus aureus subsp. aureus MRSA252] gi|49485355|ref|YP_042576.1| putative TatD related DNase [Staphylococcus aureus subsp. aureus MSSA476] gi|57651373|ref|YP_185422.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus COL] gi|87161175|ref|YP_493177.1| TatD family hydrolase [Staphylococcus aureus subsp. aureus USA300_FPR3757] gi|88194249|ref|YP_499041.1| hypothetical protein SAOUHSC_00462 [Staphylococcus aureus subsp. aureus NCTC 8325] gi|148266949|ref|YP_001245892.1| TatD family hydrolase [Staphylococcus aureus subsp. aureus JH9] gi|150392995|ref|YP_001315670.1| TatD family hydrolase [Staphylococcus aureus subsp. aureus JH1] gi|151220666|ref|YP_001331488.1| TatD related DNase [Staphylococcus aureus subsp. aureus str. Newman] gi|156978819|ref|YP_001441078.1| hypothetical protein SAHV_0488 [Staphylococcus aureus subsp. aureus Mu3] gi|161508737|ref|YP_001574396.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus USA300_TCH1516] gi|221142317|ref|ZP_03566810.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus str. JKD6009] gi|253316232|ref|ZP_04839445.1| TatD family hydrolase [Staphylococcus aureus subsp. aureus str. CF-Marseille] gi|253735225|ref|ZP_04869390.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus TCH130] gi|255005284|ref|ZP_05143885.2| TatD family hydrolase [Staphylococcus aureus subsp. aureus Mu50-omega] gi|257424602|ref|ZP_05601030.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus 55/2053] gi|257427268|ref|ZP_05603669.1| hydrolase [Staphylococcus aureus subsp. aureus 65-1322] gi|257429905|ref|ZP_05606291.1| deoxyribonuclease [Staphylococcus aureus subsp. aureus 68-397] gi|257432608|ref|ZP_05608970.1| hydrolase [Staphylococcus aureus subsp. aureus E1410] gi|257435512|ref|ZP_05611562.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus M876] gi|257794268|ref|ZP_05643247.1| hydrolase [Staphylococcus aureus A9781] gi|258407214|ref|ZP_05680359.1| hydrolase [Staphylococcus aureus A9763] gi|258420819|ref|ZP_05683755.1| TatD family deoxyribonuclease [Staphylococcus aureus A9719] gi|258429607|ref|ZP_05688281.1| hydrolase [Staphylococcus aureus A9299] gi|258446122|ref|ZP_05694283.1| TatD family hydrolase [Staphylococcus aureus A6300] gi|258448030|ref|ZP_05696160.1| TatD family hydrolase [Staphylococcus aureus A6224] gi|258452828|ref|ZP_05700823.1| hydrolase [Staphylococcus aureus A5948] gi|258453823|ref|ZP_05701796.1| TatD family hydrolase [Staphylococcus aureus A5937] gi|262049976|ref|ZP_06022835.1| hypothetical protein SAD30_0204 [Staphylococcus aureus D30] gi|262052521|ref|ZP_06024718.1| hypothetical protein SA930_1942 [Staphylococcus aureus 930918-3] gi|269202111|ref|YP_003281380.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus ED98] gi|282895098|ref|ZP_06303318.1| Mg-dependent DNase [Staphylococcus aureus A8117] gi|282903076|ref|ZP_06310968.1| deoxyribonuclease, TatD family [Staphylococcus aureus subsp. aureus C160] gi|282904866|ref|ZP_06312726.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus Btn1260] gi|282907813|ref|ZP_06315651.1| hydrolase [Staphylococcus aureus subsp. aureus WW2703/97] gi|282910129|ref|ZP_06317935.1| hydrolase [Staphylococcus aureus subsp. aureus WBG10049] gi|282913318|ref|ZP_06321109.1| deoxyribonuclease, TatD family [Staphylococcus aureus subsp. aureus M899] gi|282918272|ref|ZP_06326012.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus C427] gi|282923023|ref|ZP_06330709.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus C101] gi|282925565|ref|ZP_06333218.1| Mg-dependent DNase [Staphylococcus aureus A9765] gi|283957280|ref|ZP_06374738.1| deoxyribonuclease, TatD family [Staphylococcus aureus subsp. aureus A017934/97] gi|284023500|ref|ZP_06377898.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus 132] gi|293500367|ref|ZP_06666219.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus 58-424] gi|293509305|ref|ZP_06668021.1| deoxyribonuclease yabD [Staphylococcus aureus subsp. aureus M809] gi|293515894|ref|ZP_06670584.1| deoxyribonuclease, TatD family [Staphylococcus aureus subsp. aureus M1015] gi|294850350|ref|ZP_06791083.1| Mg-dependent DNase [Staphylococcus aureus A9754] gi|295407380|ref|ZP_06817177.1| Mg-dependent DNase [Staphylococcus aureus A8819] gi|295427025|ref|ZP_06819662.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus EMRSA16] gi|296276554|ref|ZP_06859061.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus MR1] gi|297207406|ref|ZP_06923845.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus ATCC 51811] gi|297246460|ref|ZP_06930300.1| deoxyribonuclease yabD [Staphylococcus aureus A8796] gi|297591599|ref|ZP_06950236.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus MN8] gi|300910365|ref|ZP_07127818.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus TCH70] gi|304380507|ref|ZP_07363184.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus ATCC BAA-39] gi|13700381|dbj|BAB41679.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] gi|14246259|dbj|BAB56653.1| putative deoxyribonuclease [Staphylococcus aureus subsp. aureus Mu50] gi|21203611|dbj|BAB94311.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] gi|49240847|emb|CAG39514.1| putative TatD related DNase [Staphylococcus aureus subsp. aureus MRSA252] gi|49243798|emb|CAG42223.1| putative TatD related DNase [Staphylococcus aureus subsp. aureus MSSA476] gi|57285559|gb|AAW37653.1| deoxyribonuclease, TatD family [Staphylococcus aureus subsp. aureus COL] gi|87127149|gb|ABD21663.1| hydrolase, TatD family [Staphylococcus aureus subsp. aureus USA300_FPR3757] gi|87201807|gb|ABD29617.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] gi|147740018|gb|ABQ48316.1| hydrolase, TatD family [Staphylococcus aureus subsp. aureus JH9] gi|149945447|gb|ABR51383.1| hydrolase, TatD family [Staphylococcus aureus subsp. aureus JH1] gi|150373466|dbj|BAF66726.1| TatD related DNase [Staphylococcus aureus subsp. aureus str. Newman] gi|156720954|dbj|BAF77371.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] gi|160367546|gb|ABX28517.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus USA300_TCH1516] gi|253726785|gb|EES95514.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus TCH130] gi|257272629|gb|EEV04749.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus 55/2053] gi|257275919|gb|EEV07387.1| hydrolase [Staphylococcus aureus subsp. aureus 65-1322] gi|257279421|gb|EEV10016.1| deoxyribonuclease [Staphylococcus aureus subsp. aureus 68-397] gi|257282473|gb|EEV12606.1| hydrolase [Staphylococcus aureus subsp. aureus E1410] gi|257285149|gb|EEV15266.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus M876] gi|257788240|gb|EEV26580.1| hydrolase [Staphylococcus aureus A9781] gi|257841172|gb|EEV65621.1| hydrolase [Staphylococcus aureus A9763] gi|257843211|gb|EEV67624.1| TatD family deoxyribonuclease [Staphylococcus aureus A9719] gi|257849666|gb|EEV73633.1| hydrolase [Staphylococcus aureus A9299] gi|257855099|gb|EEV78041.1| TatD family hydrolase [Staphylococcus aureus A6300] gi|257858720|gb|EEV81593.1| TatD family hydrolase [Staphylococcus aureus A6224] gi|257859514|gb|EEV82367.1| hydrolase [Staphylococcus aureus A5948] gi|257863994|gb|EEV86749.1| TatD family hydrolase [Staphylococcus aureus A5937] gi|259159568|gb|EEW44615.1| hypothetical protein SA930_1942 [Staphylococcus aureus 930918-3] gi|259161911|gb|EEW46494.1| hypothetical protein SAD30_0204 [Staphylococcus aureus D30] gi|262074401|gb|ACY10374.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus ED98] gi|269940062|emb|CBI48438.1| putative TatD related DNase [Staphylococcus aureus subsp. aureus TW20] gi|282314542|gb|EFB44929.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus C101] gi|282317838|gb|EFB48207.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus C427] gi|282322789|gb|EFB53109.1| deoxyribonuclease, TatD family [Staphylococcus aureus subsp. aureus M899] gi|282325977|gb|EFB56283.1| hydrolase [Staphylococcus aureus subsp. aureus WBG10049] gi|282328289|gb|EFB58564.1| hydrolase [Staphylococcus aureus subsp. aureus WW2703/97] gi|282331983|gb|EFB61492.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus Btn1260] gi|282592469|gb|EFB97481.1| Mg-dependent DNase [Staphylococcus aureus A9765] gi|282596502|gb|EFC01462.1| deoxyribonuclease, TatD family [Staphylococcus aureus subsp. aureus C160] gi|282762516|gb|EFC02656.1| Mg-dependent DNase [Staphylococcus aureus A8117] gi|283469783|emb|CAQ48994.1| metallo-dependent hydrolase [Staphylococcus aureus subsp. aureus ST398] gi|283791204|gb|EFC30014.1| deoxyribonuclease, TatD family [Staphylococcus aureus subsp. aureus A017934/97] gi|285816190|gb|ADC36677.1| Putative deoxyribonuclease YcfH [Staphylococcus aureus 04-02981] gi|290921302|gb|EFD98360.1| deoxyribonuclease, TatD family [Staphylococcus aureus subsp. aureus M1015] gi|291096327|gb|EFE26587.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus 58-424] gi|291467850|gb|EFF10360.1| deoxyribonuclease yabD [Staphylococcus aureus subsp. aureus M809] gi|294822774|gb|EFG39210.1| Mg-dependent DNase [Staphylococcus aureus A9754] gi|294967737|gb|EFG43769.1| Mg-dependent DNase [Staphylococcus aureus A8819] gi|295129028|gb|EFG58657.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus EMRSA16] gi|296887969|gb|EFH26863.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus ATCC 51811] gi|297176647|gb|EFH35909.1| deoxyribonuclease yabD [Staphylococcus aureus A8796] gi|297575468|gb|EFH94185.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus MN8] gi|300888354|gb|EFK83541.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus TCH70] gi|302332204|gb|ADL22397.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus JKD6159] gi|302750381|gb|ADL64558.1| Mg-dependent DNase [Staphylococcus aureus subsp. aureus str. JKD6008] gi|304340952|gb|EFM06875.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus ATCC BAA-39] gi|312436420|gb|ADQ75491.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus TCH60] gi|312828986|emb|CBX33828.1| hydrolase, TatD family protein [Staphylococcus aureus subsp. aureus ECT-R 2] gi|315128617|gb|EFT84620.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus CGS03] gi|315193852|gb|EFU24246.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus CGS00] gi|315196172|gb|EFU26528.1| TatD family deoxyribonuclease [Staphylococcus aureus subsp. aureus CGS01] gi|320139423|gb|EFW31301.1| hydrolase, TatD family [Staphylococcus aureus subsp. aureus MRSA131] gi|320144200|gb|EFW35968.1| hydrolase, TatD family [Staphylococcus aureus subsp. aureus MRSA177] gi|329313209|gb|AEB87622.1| Hydrolase, TatD family [Staphylococcus aureus subsp. aureus T0131] gi|329725038|gb|EGG61533.1| hydrolase, TatD family [Staphylococcus aureus subsp. aureus 21172] gi|329729778|gb|EGG66175.1| hydrolase, TatD family [Staphylococcus aureus subsp. aureus 21189] gi|329731095|gb|EGG67467.1| hydrolase, TatD family [Staphylococcus aureus subsp. aureus 21193] Length = 257 Score = 38.4 bits (88), Expect = 0.29, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +D+D VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDDDLSEVITRAREAGVDRMFVV 36 >gi|225874398|ref|YP_002755857.1| hydrolase, TatD family [Acidobacterium capsulatum ATCC 51196] gi|225792570|gb|ACO32660.1| hydrolase, TatD family [Acidobacterium capsulatum ATCC 51196] Length = 272 Score = 38.4 bits (88), Expect = 0.29, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 +I++H H +D+DR ++ RA QA V +++I I Sbjct: 1 MIDSHAHLDSARYDDDREAMLARAWQAGVRGILSIGI 37 >gi|319956682|ref|YP_004167945.1| hydrolase, tatd family [Nitratifractor salsuginis DSM 16511] gi|319419086|gb|ADV46196.1| hydrolase, TatD family [Nitratifractor salsuginis DSM 16511] Length = 256 Score = 38.4 bits (88), Expect = 0.30, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+++TH H P + ED V+ R+ +A V + I Sbjct: 1 MIVDTHVHLDDPKYAEDLEGVLERSREAGVARWI 34 >gi|184156881|ref|YP_001845220.1| Mg-dependent DNase [Acinetobacter baumannii ACICU] gi|294840244|ref|ZP_06784927.1| Mg-dependent DNase [Acinetobacter sp. 6014059] gi|183208475|gb|ACC55873.1| Mg-dependent DNase [Acinetobacter baumannii ACICU] gi|322506776|gb|ADX02230.1| Mg-dependent DNase [Acinetobacter baumannii 1656-2] gi|323516646|gb|ADX91027.1| Mg-dependent DNase [Acinetobacter baumannii TCDC-AB0715] Length = 270 Score = 38.4 bits (88), Expect = 0.30, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFDEDRH + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRHQLALEAKKVGVDALVLI 37 >gi|260888294|ref|ZP_05899557.1| hydrolase, TatD family [Selenomonas sputigena ATCC 35185] gi|330838377|ref|YP_004412957.1| hydrolase, TatD family [Selenomonas sputigena ATCC 35185] gi|260861830|gb|EEX76330.1| hydrolase, TatD family [Selenomonas sputigena ATCC 35185] gi|329746141|gb|AEB99497.1| hydrolase, TatD family [Selenomonas sputigena ATCC 35185] Length = 256 Score = 38.4 bits (88), Expect = 0.30, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 23/42 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 LI++H H F +DR V+ RA A V+K+I + + + Sbjct: 3 LIDSHAHLDGEKFADDRAAVVERALAAGVVKIITMGDSLESS 44 >gi|330900413|gb|EGH31832.1| TatD-related deoxyribonuclease [Pseudomonas syringae pv. japonica str. M301072PT] Length = 153 Score = 38.4 bits (88), Expect = 0.30, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ V +M+ + + Sbjct: 5 LIDTHTHLDFADFDADRAQVLDNCLALGVQRMVVLGV 41 >gi|162147585|ref|YP_001602046.1| putative deoxyribonuclease [Gluconacetobacter diazotrophicus PAl 5] gi|209542218|ref|YP_002274447.1| TatD family hydrolase [Gluconacetobacter diazotrophicus PAl 5] gi|161786162|emb|CAP55744.1| putative deoxyribonuclease [Gluconacetobacter diazotrophicus PAl 5] gi|209529895|gb|ACI49832.1| hydrolase, TatD family [Gluconacetobacter diazotrophicus PAl 5] Length = 263 Score = 38.4 bits (88), Expect = 0.30, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 LI++HCH D++ +++ RA QA V M+ I ++ R Sbjct: 4 LIDSHCHLDHFT-DDEIPDLLDRARQAGVEGMVTIGTRLSR 43 >gi|77165134|ref|YP_343659.1| TatD-related deoxyribonuclease [Nitrosococcus oceani ATCC 19707] gi|254433903|ref|ZP_05047411.1| hydrolase, TatD family [Nitrosococcus oceani AFC27] gi|76883448|gb|ABA58129.1| TatD-related deoxyribonuclease [Nitrosococcus oceani ATCC 19707] gi|207090236|gb|EDZ67507.1| hydrolase, TatD family [Nitrosococcus oceani AFC27] Length = 261 Score = 38.4 bits (88), Expect = 0.30, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Query: 1 MLINTHCHFLLPD---FDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH L D FD H+V+ + +A + M+ +++ + Sbjct: 1 MLVDSHCHLNLLDLTPFDGSVHSVMEESRKAGISHMLCVSVDLE 44 >gi|289551710|ref|YP_003472614.1| Putative deoxyribonuclease YcfH [Staphylococcus lugdunensis HKU09-01] gi|289181241|gb|ADC88486.1| Putative deoxyribonuclease YcfH [Staphylococcus lugdunensis HKU09-01] Length = 256 Score = 38.4 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 17/36 (47%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +DED VI RA QA V +M + Sbjct: 1 MLIDTHVHLNDEQYDEDLSEVISRAQQAGVDRMFVV 36 >gi|269137839|ref|YP_003294539.1| putative deoxyribonuclease [Edwardsiella tarda EIB202] gi|267983499|gb|ACY83328.1| putative deoxyribonuclease [Edwardsiella tarda EIB202] gi|304557893|gb|ADM40557.1| Putative deoxyribonuclease YjjV [Edwardsiella tarda FL6-60] Length = 263 Score = 38.4 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 21/41 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 LI+THCHF F D + RA A + +I +I+ R Sbjct: 6 LIDTHCHFDFAPFCGDEAASLHRARAAGIGDIIVPSIEASR 46 >gi|33865146|ref|NP_896705.1| deoxyribonuclease TatD [Synechococcus sp. WH 8102] gi|33638830|emb|CAE07127.1| possible deoxyribonuclease similar to TatD [Synechococcus sp. WH 8102] Length = 262 Score = 38.4 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + +FD+D V R +A V ++ ++ Sbjct: 7 LIDSHCHIVFRNFDDDLDEVASRWREAGVKALLHACVE 44 >gi|315585979|gb|ADU40360.1| TatD family hydrolase [Helicobacter pylori 35A] Length = 254 Score = 38.4 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ ++ + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKKSLEKGVTQCV 34 >gi|296135951|ref|YP_003643193.1| hydrolase, TatD family [Thiomonas intermedia K12] gi|295796073|gb|ADG30863.1| hydrolase, TatD family [Thiomonas intermedia K12] Length = 268 Score = 38.4 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 18/40 (45%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 L ++HCH P +E +V+ H V + + I + Sbjct: 13 LTDSHCHLAYPGLEERLDDVLAHMHDKGVTRALNICTTLE 52 >gi|262280975|ref|ZP_06058758.1| conserved hypothetical protein [Acinetobacter calcoaceticus RUH2202] gi|262257875|gb|EEY76610.1| conserved hypothetical protein [Acinetobacter calcoaceticus RUH2202] Length = 270 Score = 38.4 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFDEDR + + A +A V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRQQLALNAKKAGVDALVLI 37 >gi|315660342|ref|ZP_07913195.1| TatD family deoxyribonuclease [Staphylococcus lugdunensis M23590] gi|315494631|gb|EFU82973.1| TatD family deoxyribonuclease [Staphylococcus lugdunensis M23590] Length = 257 Score = 38.4 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 17/36 (47%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +DED VI RA QA V +M + Sbjct: 2 MLIDTHVHLNDEQYDEDLSEVISRAQQAGVDRMFVV 37 >gi|149184558|ref|ZP_01862876.1| Mg-dependent DNase [Erythrobacter sp. SD-21] gi|148831878|gb|EDL50311.1| Mg-dependent DNase [Erythrobacter sp. SD-21] Length = 258 Score = 38.4 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 21/39 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 ML+++HCH E++ +V+ RA V + I+ K Sbjct: 1 MLVDSHCHLEYEGLVENQSDVLDRARGVGVGAFLNISTK 39 >gi|297581851|ref|ZP_06943772.1| conserved hypothetical protein [Vibrio cholerae RC385] gi|297533945|gb|EFH72785.1| conserved hypothetical protein [Vibrio cholerae RC385] Length = 255 Score = 38.4 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKIL 33 >gi|209694207|ref|YP_002262135.1| putative DNase [Aliivibrio salmonicida LFI1238] gi|208008158|emb|CAQ78300.1| putative DNase [Aliivibrio salmonicida LFI1238] Length = 258 Score = 38.4 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI++HCHF P F ++ + +A V K+I Sbjct: 5 LIDSHCHFDFPPFKDNELFYLEKARSVGVKKLI 37 >gi|193076353|gb|ABO11010.2| hypothetical protein A1S_0557 [Acinetobacter baumannii ATCC 17978] Length = 276 Score = 38.4 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFDEDRH + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRHQLALEAKKVGVDALVLI 37 >gi|237653165|ref|YP_002889479.1| hydrolase, TatD family [Thauera sp. MZ1T] gi|237624412|gb|ACR01102.1| hydrolase, TatD family [Thauera sp. MZ1T] Length = 258 Score = 38.4 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 17/41 (41%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH P E ++ V + I +++ Sbjct: 1 MFVDSHCHLDFPGLAEREDEILATMAANGVGTALCIGVRLE 41 >gi|229520101|ref|ZP_04409529.1| hypothetical protein VIF_000617 [Vibrio cholerae TM 11079-80] gi|229342889|gb|EEO07879.1| hypothetical protein VIF_000617 [Vibrio cholerae TM 11079-80] Length = 255 Score = 38.4 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 22/39 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I+TH H +FD DR VI RA Q + K++ I V Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKILMPNIDV 39 >gi|89092079|ref|ZP_01165034.1| hydrolase, TatD family protein [Oceanospirillum sp. MED92] gi|89083814|gb|EAR63031.1| hydrolase, TatD family protein [Oceanospirillum sp. MED92] Length = 258 Score = 38.4 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+THCH FDE R +VI A + V ++ Sbjct: 3 LIDTHCHIDFSVFDEKRSDVITEAARLGVSDIV 35 >gi|325955636|ref|YP_004239296.1| hydrolase, TatD family [Weeksella virosa DSM 16922] gi|323438254|gb|ADX68718.1| hydrolase, TatD family [Weeksella virosa DSM 16922] Length = 256 Score = 38.4 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 18/32 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 MLI+TH H FDEDR +I RA V + Sbjct: 1 MLIDTHTHLYSEQFDEDRDEMIQRALAVGVEQ 32 >gi|219871221|ref|YP_002475596.1| putative Mg-dependent DNAse [Haemophilus parasuis SH0165] gi|219691425|gb|ACL32648.1| putative Mg-dependent DNAse [Haemophilus parasuis SH0165] Length = 260 Score = 38.4 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAIKVIR 42 +I++HCH D++ VI A V +MI+I + R Sbjct: 6 IIDSHCHLDSLDYETRHKNVDEVIDNAKARGVQQMISICTTLGR 49 >gi|315127465|ref|YP_004069468.1| hydrolase [Pseudoalteromonas sp. SM9913] gi|315015979|gb|ADT69317.1| hydrolase [Pseudoalteromonas sp. SM9913] Length = 255 Score = 38.4 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I++HCH +FD +R ++I V + I Sbjct: 3 FIDSHCHLDFSEFDANRESLINACVAKGVSQFI 35 >gi|68171787|ref|ZP_00545130.1| TatD-related deoxyribonuclease [Ehrlichia chaffeensis str. Sapulpa] gi|88658121|ref|YP_507591.1| TatD family hydrolase [Ehrlichia chaffeensis str. Arkansas] gi|67998788|gb|EAM85497.1| TatD-related deoxyribonuclease [Ehrlichia chaffeensis str. Sapulpa] gi|88599578|gb|ABD45047.1| hydrolase, TatD family [Ehrlichia chaffeensis str. Arkansas] Length = 260 Score = 38.4 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M++++HCH D E + V++RA + NV M + + Sbjct: 1 MIVDSHCHLNYFDPSEIKD-VVLRAEENNVKLMQTVCTTI 39 >gi|148243059|ref|YP_001228216.1| Mg-dependent DNase [Synechococcus sp. RCC307] gi|147851369|emb|CAK28863.1| Mg-dependent DNase [Synechococcus sp. RCC307] Length = 276 Score = 38.4 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + FD+D + R +A V ++ ++ Sbjct: 7 LIDSHCHIVFRQFDDDLDVIAARWREAGVQSLLHACVE 44 >gi|285017926|ref|YP_003375637.1| hypothetical protein XALc_1135 [Xanthomonas albilineans GPE PC73] gi|283473144|emb|CBA15650.1| conserved hypothetical protein [Xanthomonas albilineans] Length = 261 Score = 38.4 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH FD DR VI RA A V+ I A+ Sbjct: 3 LIDSHCHLDADAFDHDRAAVIARAQNAGVVAQIVPAV 39 >gi|153827720|ref|ZP_01980387.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|149737803|gb|EDM52708.1| conserved hypothetical protein [Vibrio cholerae MZO-2] Length = 255 Score = 38.4 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKIL 33 >gi|15640135|ref|NP_229762.1| hypothetical protein VC0103 [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121730179|ref|ZP_01682571.1| conserved hypothetical protein [Vibrio cholerae V52] gi|147675353|ref|YP_001218315.1| hypothetical protein VC0395_A2415 [Vibrio cholerae O395] gi|227080339|ref|YP_002808890.1| Putative deoxyribonuclease yabD [Vibrio cholerae M66-2] gi|229508384|ref|ZP_04397888.1| hypothetical protein VCF_003619 [Vibrio cholerae BX 330286] gi|229508935|ref|ZP_04398425.1| hypothetical protein VCE_000339 [Vibrio cholerae B33] gi|229517049|ref|ZP_04406495.1| hypothetical protein VCC_001070 [Vibrio cholerae RC9] gi|229606658|ref|YP_002877306.1| hypothetical protein VCD_001567 [Vibrio cholerae MJ-1236] gi|254851488|ref|ZP_05240838.1| conserved hypothetical protein [Vibrio cholerae MO10] gi|255743940|ref|ZP_05417895.1| putative deoxyribonuclease similar to YcfH type 2 [Vibrio cholera CIRS 101] gi|298501124|ref|ZP_07010924.1| conserved hypothetical protein [Vibrio cholerae MAK 757] gi|9654502|gb|AAF93281.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121628070|gb|EAX60612.1| conserved hypothetical protein [Vibrio cholerae V52] gi|146317236|gb|ABQ21775.1| conserved hypothetical protein [Vibrio cholerae O395] gi|227008227|gb|ACP04439.1| Putative deoxyribonuclease yabD [Vibrio cholerae M66-2] gi|227011895|gb|ACP08105.1| Putative deoxyribonuclease yabD [Vibrio cholerae O395] gi|229346112|gb|EEO11084.1| hypothetical protein VCC_001070 [Vibrio cholerae RC9] gi|229354052|gb|EEO18985.1| hypothetical protein VCE_000339 [Vibrio cholerae B33] gi|229354657|gb|EEO19579.1| hypothetical protein VCF_003619 [Vibrio cholerae BX 330286] gi|229369313|gb|ACQ59736.1| hypothetical protein VCD_001567 [Vibrio cholerae MJ-1236] gi|254847193|gb|EET25607.1| conserved hypothetical protein [Vibrio cholerae MO10] gi|255738423|gb|EET93813.1| putative deoxyribonuclease similar to YcfH type 2 [Vibrio cholera CIRS 101] gi|297540158|gb|EFH76219.1| conserved hypothetical protein [Vibrio cholerae MAK 757] Length = 255 Score = 38.4 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKIL 33 >gi|298693821|gb|ADI97043.1| deoxyribonuclease, TatD family [Staphylococcus aureus subsp. aureus ED133] Length = 257 Score = 38.4 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +D+D VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDDDLGEVITRAREAGVDRMFVV 36 >gi|255322552|ref|ZP_05363697.1| hydrolase, TatD family [Campylobacter showae RM3277] gi|255300460|gb|EET79732.1| hydrolase, TatD family [Campylobacter showae RM3277] Length = 261 Score = 38.4 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 17/31 (54%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVL 31 M+I+THCH FD D VI AH+ V Sbjct: 1 MIIDTHCHLDDESFDNDLVKVIANAHENGVG 31 >gi|62258322|gb|AAX77782.1| unknown protein [synthetic construct] Length = 283 Score = 38.4 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R N++ ++ V I A + Sbjct: 27 MFIDTHCHLDFDIFDKTRQNILQNCNKLGVNYFINPATQ 65 >gi|194334461|ref|YP_002016321.1| hydrolase, TatD family [Prosthecochloris aestuarii DSM 271] gi|194312279|gb|ACF46674.1| hydrolase, TatD family [Prosthecochloris aestuarii DSM 271] Length = 269 Score = 38.4 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ML++ H H P+FD+DR +I R + NV +I Sbjct: 1 MLVDVHSHLSFPEFDQDRPEIIQRMLEHNVGYLI 34 >gi|296535549|ref|ZP_06897731.1| TatD family hydrolase [Roseomonas cervicalis ATCC 49957] gi|296264135|gb|EFH10578.1| TatD family hydrolase [Roseomonas cervicalis ATCC 49957] Length = 257 Score = 38.4 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 ML+++HCH + + +++ RA A V +M+ I +++ ++ Sbjct: 1 MLVDSHCHLDYFT-EAEIEDILARAAAAGVGRMVTIGVRMSQS 42 >gi|332172893|gb|AEE22147.1| TatD-related deoxyribonuclease [Glaciecola agarilytica 4H-3-7+YE-5] Length = 256 Score = 38.4 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 17/38 (44%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 +I++HCH FD DR V+ + V + + Sbjct: 1 MIDSHCHLDFTAFDSDREQVLQTCTERGVSTFVIPGTQ 38 >gi|254292251|ref|ZP_04963012.1| conserved hypothetical protein [Vibrio cholerae AM-19226] gi|150421836|gb|EDN13822.1| conserved hypothetical protein [Vibrio cholerae AM-19226] Length = 255 Score = 38.0 bits (87), Expect = 0.37, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKIL 33 >gi|242309110|ref|ZP_04808265.1| hydrolase [Helicobacter pullorum MIT 98-5489] gi|239524151|gb|EEQ64017.1| hydrolase [Helicobacter pullorum MIT 98-5489] Length = 269 Score = 38.0 bits (87), Expect = 0.38, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCH F+ D V+ RA +A + + + Sbjct: 3 LCDTHCHLDDKRFEGDFEAVLERAKKAGITRFV 35 >gi|322436203|ref|YP_004218415.1| hydrolase, TatD family [Acidobacterium sp. MP5ACTX9] gi|321163930|gb|ADW69635.1| hydrolase, TatD family [Acidobacterium sp. MP5ACTX9] Length = 281 Score = 38.0 bits (87), Expect = 0.39, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 MLI++H H D D +++RA A V +M+AI I Sbjct: 7 MLIDSHAHLDFYD---DPTEILVRAEAAGVAQMLAIGI 41 >gi|192359359|ref|YP_001982452.1| deoxyribonuclease, TatD family [Cellvibrio japonicus Ueda107] gi|190685524|gb|ACE83202.1| deoxyribonuclease, TatD family [Cellvibrio japonicus Ueda107] Length = 267 Score = 38.0 bits (87), Expect = 0.39, Method: Composition-based stats. Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Query: 1 MLINTHCHFL---LPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M++++HCH L +D + + AH + +M+ I I + Sbjct: 5 MIVDSHCHLDRLNLAAYDGNLDEAVAAAHARGIQQMLCIGISLE 48 >gi|73540780|ref|YP_295300.1| TatD-related deoxyribonuclease [Ralstonia eutropha JMP134] gi|72118193|gb|AAZ60456.1| TatD-related deoxyribonuclease [Ralstonia eutropha JMP134] Length = 277 Score = 38.0 bits (87), Expect = 0.39, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 21/40 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M I+THCH +FD DR V A A V ++ A+ V Sbjct: 1 MWIDTHCHLDAREFDADRGRVADAAEAAGVTGIVVPAVAV 40 >gi|66472612|ref|NP_001018405.1| putative deoxyribonuclease tatdn3 [Danio rerio] gi|82192826|sp|Q503T5|TATD3_DANRE RecName: Full=Putative deoxyribonuclease tatdn3 gi|63101823|gb|AAH95191.1| TatD DNase domain containing 3 [Danio rerio] Length = 266 Score = 38.0 bits (87), Expect = 0.39, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 21/36 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I+ HCH +F D +V++RA +A V ++A+ Sbjct: 5 FIDCHCHISASEFTTDTDDVLLRAKKAGVKALVAVT 40 >gi|332042233|gb|EGI78559.1| hydrolase, TatD family protein [Hylemonella gracilis ATCC 19624] Length = 276 Score = 38.0 bits (87), Expect = 0.39, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 17/41 (41%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M ++HCH P+ D + A V + + I ++ Sbjct: 1 MYTDSHCHLNFPELRSDLPAIRTAMRAAGVERALCICTRLE 41 >gi|318042320|ref|ZP_07974276.1| deoxyribonuclease TatD [Synechococcus sp. CB0101] Length = 273 Score = 38.0 bits (87), Expect = 0.40, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + +FDED V R A V +++ ++ Sbjct: 14 LIDSHCHIVFRNFDEDLEEVAQRWRDAGVGRLLHACVE 51 >gi|283835043|ref|ZP_06354784.1| deoxyribonuclease, TatD family [Citrobacter youngae ATCC 29220] gi|291069332|gb|EFE07441.1| deoxyribonuclease, TatD family [Citrobacter youngae ATCC 29220] Length = 258 Score = 38.0 bits (87), Expect = 0.40, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 19/38 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F +D I RA V +I A + Sbjct: 5 FIDTHCHFDFPPFTDDEPASIQRAAAVGVHSIIVPATQ 42 >gi|229525002|ref|ZP_04414407.1| hypothetical protein VCA_002611 [Vibrio cholerae bv. albensis VL426] gi|229338583|gb|EEO03600.1| hypothetical protein VCA_002611 [Vibrio cholerae bv. albensis VL426] Length = 255 Score = 38.0 bits (87), Expect = 0.40, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKIL 33 >gi|254374153|ref|ZP_04989635.1| conserved hypothetical protein [Francisella novicida GA99-3548] gi|151571873|gb|EDN37527.1| conserved hypothetical protein [Francisella novicida GA99-3548] Length = 248 Score = 38.0 bits (87), Expect = 0.40, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R N++ ++ + I A + Sbjct: 1 MFIDTHCHLDFDIFDKTRQNILQNCNKLGINYFINPATQ 39 >gi|29347466|ref|NP_810969.1| hypothetical protein BT_2056 [Bacteroides thetaiotaomicron VPI-5482] gi|29339366|gb|AAO77163.1| hydrolase, putative [Bacteroides thetaiotaomicron VPI-5482] Length = 258 Score = 38.0 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 MLI+TH H L +F +D V+ RA QA V ++ Sbjct: 1 MLIDTHSHLFLEEFSDDLPQVMERARQAGVSRI 33 >gi|291618855|ref|YP_003521597.1| YjjV [Pantoea ananatis LMG 20103] gi|291153885|gb|ADD78469.1| YjjV [Pantoea ananatis LMG 20103] Length = 257 Score = 38.0 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 21/41 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++THCHF P F + RA Q+ V K+I ++ R Sbjct: 3 FVDTHCHFDFPPFVGQAAESLARAAQSGVEKIIVPSVDAGR 43 >gi|239637477|ref|ZP_04678451.1| TatD deoxyribonuclease [Staphylococcus warneri L37603] gi|239596922|gb|EEQ79445.1| TatD deoxyribonuclease [Staphylococcus warneri L37603] Length = 258 Score = 38.0 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED ++VI RA + V +M + + RT+ L Sbjct: 1 MLIDTHVHLNDEQYDEDLNDVITRAREDGVDRMFVVGFDTPTIERTMEL 49 >gi|78213584|ref|YP_382363.1| TatD-related deoxyribonuclease [Synechococcus sp. CC9605] gi|78198043|gb|ABB35808.1| TatD-related deoxyribonuclease [Synechococcus sp. CC9605] Length = 262 Score = 38.0 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + +FD+D V R +A V ++ ++ Sbjct: 7 LIDSHCHIVFRNFDDDLDEVASRWREAGVGALLHACVE 44 >gi|269103388|ref|ZP_06156085.1| putative deoxyribonuclease YjjV [Photobacterium damselae subsp. damselae CIP 102761] gi|268163286|gb|EEZ41782.1| putative deoxyribonuclease YjjV [Photobacterium damselae subsp. damselae CIP 102761] Length = 305 Score = 38.0 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI++HCHF F + ++ + +A QA V ++ Sbjct: 42 MLIDSHCHFDFEPFIQAPNSYLEQAKQAGVGAIV 75 >gi|148553411|ref|YP_001260993.1| TatD family hydrolase [Sphingomonas wittichii RW1] gi|148498601|gb|ABQ66855.1| hydrolase, TatD family [Sphingomonas wittichii RW1] Length = 258 Score = 38.0 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 19/39 (48%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M +++HCH + + V+ A A V M+ I+ + Sbjct: 1 MFVDSHCHLNYSGLADRQQEVLSAARAAGVSTMLNISTR 39 >gi|258591915|emb|CBE68220.1| Putative deoxyribonuclease (ycfH) [NC10 bacterium 'Dutch sediment'] Length = 264 Score = 38.0 bits (87), Expect = 0.43, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H + +FD DR + RA A + M+A+ Sbjct: 1 MLIDTHAHIQMQEFDHDRAEALTRAEAAGIGLMLAV 36 >gi|152996287|ref|YP_001341122.1| TatD family hydrolase [Marinomonas sp. MWYL1] gi|150837211|gb|ABR71187.1| hydrolase, TatD family [Marinomonas sp. MWYL1] Length = 266 Score = 38.0 bits (87), Expect = 0.43, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNV---IMRAHQANVLKMIAIAIKVIR 42 MLI+THCH + D +++ I A++ V +++ I++ + + Sbjct: 1 MLIDTHCHLDMLDLAPHNNDINSVIDAAYRKGVRQLLTISVDLNK 45 >gi|253570681|ref|ZP_04848089.1| conserved hypothetical protein [Bacteroides sp. 1_1_6] gi|298385076|ref|ZP_06994635.1| hydrolase, TatD family [Bacteroides sp. 1_1_14] gi|251839630|gb|EES67713.1| conserved hypothetical protein [Bacteroides sp. 1_1_6] gi|298262220|gb|EFI05085.1| hydrolase, TatD family [Bacteroides sp. 1_1_14] Length = 258 Score = 38.0 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 MLI+TH H L +F +D V+ RA QA V ++ Sbjct: 1 MLIDTHSHLFLEEFSDDLPQVMERARQAGVSRI 33 >gi|86607382|ref|YP_476145.1| TatD family hydrolase [Synechococcus sp. JA-3-3Ab] gi|86555924|gb|ABD00882.1| hydrolase, TatD family [Synechococcus sp. JA-3-3Ab] Length = 261 Score = 38.0 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 19/36 (52%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ++TH H PDF ED V R QA + +++ + Sbjct: 1 MDTHVHLNYPDFAEDLPQVAERWRQAGIQQLVHSCV 36 >gi|56479159|ref|YP_160748.1| putative tatD deoxyribonuclease [Aromatoleum aromaticum EbN1] gi|56315202|emb|CAI09847.1| putative tatD deoxyribonuclease [Aromatoleum aromaticum EbN1] Length = 263 Score = 38.0 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 22/40 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML++TH H +F+ DR V+ A A + + + ++V Sbjct: 9 MLVDTHIHLDADEFEHDREAVLASARSAGIARFVVPGVEV 48 >gi|293610328|ref|ZP_06692629.1| conserved hypothetical protein [Acinetobacter sp. SH024] gi|292827560|gb|EFF85924.1| conserved hypothetical protein [Acinetobacter sp. SH024] Length = 270 Score = 38.0 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFDEDR + A +A V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRQQLAFNAKKAGVDALVLI 37 >gi|170733466|ref|YP_001765413.1| TatD-related deoxyribonuclease [Burkholderia cenocepacia MC0-3] gi|169816708|gb|ACA91291.1| TatD-related deoxyribonuclease [Burkholderia cenocepacia MC0-3] Length = 262 Score = 38.0 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V AH A V +++ +I Sbjct: 1 MWIDTHCHLDAAEFDADRDAVAQAAHAAGVSRIVIPSI 38 >gi|77359611|ref|YP_339186.1| hydrolase [Pseudoalteromonas haloplanktis TAC125] gi|76874522|emb|CAI85743.1| putative hydrolase with metallo-dependent hydrolase domain [Pseudoalteromonas haloplanktis TAC125] Length = 255 Score = 38.0 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I++HCH +FD +R ++I V + + Sbjct: 3 FIDSHCHLDFTEFDSNRESLISECVAKGVEQFV 35 >gi|107028708|ref|YP_625803.1| TatD-related deoxyribonuclease [Burkholderia cenocepacia AU 1054] gi|116690133|ref|YP_835756.1| TatD-related deoxyribonuclease [Burkholderia cenocepacia HI2424] gi|105897872|gb|ABF80830.1| TatD-related deoxyribonuclease [Burkholderia cenocepacia AU 1054] gi|116648222|gb|ABK08863.1| TatD-related deoxyribonuclease [Burkholderia cenocepacia HI2424] Length = 262 Score = 38.0 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V AH A V +++ +I Sbjct: 1 MWIDTHCHLDAAEFDADRDAVAQAAHAAGVSRIVIPSI 38 >gi|330686059|gb|EGG97681.1| hydrolase, TatD family [Staphylococcus epidermidis VCU121] Length = 256 Score = 38.0 bits (87), Expect = 0.45, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI---AIKVIRTLFL 46 MLI+TH H +DED ++VI RA + V +M + + RT+ L Sbjct: 1 MLIDTHVHLNDEQYDEDLNDVITRAREDGVDRMFVVGFDTPTIERTMEL 49 >gi|317108170|ref|NP_001186951.1| TatD DNase domain containing 3-like [Danio rerio] Length = 267 Score = 38.0 bits (87), Expect = 0.45, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 22/35 (62%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I+ HCH DFD D +V+ + +A ++ ++A+A Sbjct: 5 IDCHCHISAEDFDSDIDDVVAESRKAGLVALLAVA 39 >gi|172056077|ref|YP_001812537.1| TatD family hydrolase [Exiguobacterium sibiricum 255-15] gi|171988598|gb|ACB59520.1| hydrolase, TatD family [Exiguobacterium sibiricum 255-15] Length = 255 Score = 38.0 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 17/36 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H FD D I RA V MI + Sbjct: 1 MLIDTHTHLNSDQFDGDVEETIERARANGVSPMIVV 36 >gi|145589647|ref|YP_001156244.1| TatD-related deoxyribonuclease [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] gi|145048053|gb|ABP34680.1| TatD-related deoxyribonuclease [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] Length = 278 Score = 38.0 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 21/39 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH P+F + VI A + NV ++ ++ Sbjct: 1 MWIDTHCHLDAPEFAPNLPAVIAAAKERNVKAILLPTVR 39 >gi|300724608|ref|YP_003713933.1| putative hydrolase [Xenorhabdus nematophila ATCC 19061] gi|297631150|emb|CBJ91841.1| putative hydrolase with metallo-dependent hydrolase domain [Xenorhabdus nematophila ATCC 19061] Length = 256 Score = 38.0 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCHF P F + + A Q V K+I Sbjct: 1 MFIDTHCHFDFPPFAGNETTSLELAGQMGVEKII 34 >gi|206560546|ref|YP_002231311.1| putative TatD related DNase [Burkholderia cenocepacia J2315] gi|198036588|emb|CAR52485.1| putative TatD related DNase [Burkholderia cenocepacia J2315] Length = 262 Score = 38.0 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 21/38 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V A A V +++ +I Sbjct: 1 MWIDTHCHLDAAEFDADRDAVAQAARAAGVSRIVIPSI 38 >gi|289628841|ref|ZP_06461795.1| TatD family hydrolase [Pseudomonas syringae pv. aesculi str. NCPPB3681] gi|289651017|ref|ZP_06482360.1| TatD family hydrolase [Pseudomonas syringae pv. aesculi str. 2250] gi|330867384|gb|EGH02093.1| TatD family hydrolase [Pseudomonas syringae pv. aesculi str. 0893_23] Length = 266 Score = 38.0 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ V +++ + + Sbjct: 5 LIDTHTHLDFADFDADRAQVLDSCLALGVQRIVVLGV 41 >gi|238918506|ref|YP_002932020.1| hypothetical protein NT01EI_0556 [Edwardsiella ictaluri 93-146] gi|238868074|gb|ACR67785.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146] Length = 263 Score = 38.0 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 20/41 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 LI+THCHF F D + RA A + +I +I R Sbjct: 6 LIDTHCHFDFAPFCGDEVASLRRARAAGIGDIIVPSIDATR 46 >gi|194289279|ref|YP_002005186.1| dnase, hydrolase with metallo-dependent hydrolase domain [Cupriavidus taiwanensis LMG 19424] gi|193223114|emb|CAQ69119.1| putative DNAse, hydrolase with metallo-dependent hydrolase domain [Cupriavidus taiwanensis LMG 19424] Length = 286 Score = 38.0 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 20/38 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V A A V ++ A+ Sbjct: 1 MWIDTHCHLDAGEFDPDREQVADAAEAAGVRGIVVPAV 38 >gi|187250524|ref|YP_001875006.1| Mg-dependent DNase [Elusimicrobium minutum Pei191] gi|186970684|gb|ACC97669.1| Mg-dependent DNase [Elusimicrobium minutum Pei191] Length = 269 Score = 38.0 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 18/35 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 I++H H P FD DR VI +A V +I I Sbjct: 7 FIDSHAHMTDPAFDSDRDAVIKSCFEAGVKNIIEI 41 >gi|254247795|ref|ZP_04941116.1| Mg-dependent DNase [Burkholderia cenocepacia PC184] gi|124872571|gb|EAY64287.1| Mg-dependent DNase [Burkholderia cenocepacia PC184] Length = 262 Score = 38.0 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V AH A V +++ +I Sbjct: 1 MWIDTHCHLDAAEFDADRDAVAQAAHAAGVSRIVIPSI 38 >gi|300726784|ref|ZP_07060214.1| hydrolase, TatD family [Prevotella bryantii B14] gi|299775897|gb|EFI72477.1| hydrolase, TatD family [Prevotella bryantii B14] Length = 266 Score = 38.0 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 I+TH H + +F ED VI+RA +A V K+ Sbjct: 3 FIDTHAHLDVEEFAEDLPEVIIRAKEAGVAKI 34 >gi|294649310|ref|ZP_06726744.1| TatD family hydrolase [Acinetobacter haemolyticus ATCC 19194] gi|292824807|gb|EFF83576.1| TatD family hydrolase [Acinetobacter haemolyticus ATCC 19194] Length = 271 Score = 38.0 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFD+DR + ++A Q V +I I Sbjct: 3 LFDTHTHFDVADFDQDRQQLAVQAKQVGVEALILI 37 >gi|288926234|ref|ZP_06420160.1| hydrolase, TatD family [Prevotella buccae D17] gi|288337013|gb|EFC75373.1| hydrolase, TatD family [Prevotella buccae D17] Length = 262 Score = 38.0 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 +I+TH H + DF D V+ RA +A V K+ Sbjct: 1 MIDTHAHLDVEDFHADLPEVMARAREAGVEKV 32 >gi|50086101|ref|YP_047611.1| hypothetical protein ACIAD3091 [Acinetobacter sp. ADP1] gi|49532077|emb|CAG69789.1| conserved hypothetical protein; putative enzyme [Acinetobacter sp. ADP1] Length = 272 Score = 38.0 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF +PDFD DR + +A A V ++ I Sbjct: 4 LFDTHTHFDVPDFDADRILLAQQAKNAGVDALVLI 38 >gi|317493755|ref|ZP_07952172.1| TatD family hydrolase [Enterobacteriaceae bacterium 9_2_54FAA] gi|316918082|gb|EFV39424.1| TatD family hydrolase [Enterobacteriaceae bacterium 9_2_54FAA] Length = 267 Score = 38.0 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 19/41 (46%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F + + I A+ V +I I R Sbjct: 10 FIDTHCHFDFPPFSGNESDSIALAYAQGVRHIIVPTISAER 50 >gi|323497917|ref|ZP_08102926.1| hypothetical protein VISI1226_07742 [Vibrio sinaloensis DSM 21326] gi|323316962|gb|EGA69964.1| hypothetical protein VISI1226_07742 [Vibrio sinaloensis DSM 21326] Length = 257 Score = 38.0 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCH F +D + + AH+ V ++I +I Sbjct: 3 LFDTHCHLDFAPFADDIDSHVALAHRNKVERIIVPSI 39 >gi|226952904|ref|ZP_03823368.1| TatD family Mg-dependent DNase [Acinetobacter sp. ATCC 27244] gi|226836349|gb|EEH68732.1| TatD family Mg-dependent DNase [Acinetobacter sp. ATCC 27244] Length = 271 Score = 37.6 bits (86), Expect = 0.49, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFD+DR + ++A Q V +I I Sbjct: 3 LFDTHTHFDVADFDQDRQQLAVQAKQVGVEALILI 37 >gi|262404676|ref|ZP_06081231.1| putative deoxyribonuclease YjjV [Vibrio sp. RC586] gi|262349708|gb|EEY98846.1| putative deoxyribonuclease YjjV [Vibrio sp. RC586] Length = 271 Score = 37.6 bits (86), Expect = 0.50, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCHF F + + RA + V +++ Sbjct: 10 LFDTHCHFDFAPFAAEPELELQRAAEQGVKRLL 42 >gi|223983396|ref|ZP_03633582.1| hypothetical protein HOLDEFILI_00862 [Holdemania filiformis DSM 12042] gi|223964568|gb|EEF68894.1| hypothetical protein HOLDEFILI_00862 [Holdemania filiformis DSM 12042] Length = 262 Score = 37.6 bits (86), Expect = 0.50, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I++HCH D D +V RA A V +M+ + ++ Sbjct: 8 IDSHCHLTCADLIGDAWDVRQRALDAGVARMMIVCCRLE 46 >gi|78485065|ref|YP_390990.1| TatD-related deoxyribonuclease [Thiomicrospira crunogena XCL-2] gi|78363351|gb|ABB41316.1| TatD-related deoxyribonuclease [Thiomicrospira crunogena XCL-2] Length = 257 Score = 37.6 bits (86), Expect = 0.50, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Query: 1 MLINTHCHFL-LPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M+I++HCH LP+ VI +AH+ V KM+ IAI Sbjct: 1 MIIDSHCHLNILPEEIGTTEEVIQQAHELGVDKMMCIAI 39 >gi|325288366|ref|YP_004264547.1| hydrolase, TatD family [Syntrophobotulus glycolicus DSM 8271] gi|324963767|gb|ADY54546.1| hydrolase, TatD family [Syntrophobotulus glycolicus DSM 8271] Length = 254 Score = 37.6 bits (86), Expect = 0.51, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+ +TH H FD+D V+ RA +A + ++I Sbjct: 1 MIWDTHAHLDDEQFDQDLSAVLERAKEAGITQII 34 >gi|121607996|ref|YP_995803.1| TatD family hydrolase [Verminephrobacter eiseniae EF01-2] gi|121552636|gb|ABM56785.1| hydrolase, TatD family [Verminephrobacter eiseniae EF01-2] Length = 265 Score = 37.6 bits (86), Expect = 0.51, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 17/41 (41%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M ++HCH P+ H + QA V + + I + Sbjct: 1 MFTDSHCHLDFPELRGQLHAIRQAMAQAQVDRALCICTTIE 41 >gi|257484030|ref|ZP_05638071.1| TatD family hydrolase [Pseudomonas syringae pv. tabaci ATCC 11528] gi|331013048|gb|EGH93104.1| TatD family hydrolase [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 266 Score = 37.6 bits (86), Expect = 0.51, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ V +++ + + Sbjct: 5 LIDTHTHLDFADFDADRAQVLDSCLSLGVQRIVVLGV 41 >gi|145589147|ref|YP_001155744.1| TatD family hydrolase [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] gi|145047553|gb|ABP34180.1| hydrolase, TatD family [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] Length = 263 Score = 37.6 bits (86), Expect = 0.52, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M I++HCH P+F V+ +A V + +++ + Sbjct: 1 MFIDSHCHLDFPEFQARLPEVLANMEKAQVSHGLCVSVDI 40 >gi|328676815|gb|AEB27685.1| Putative deoxyribonuclease YjjV [Francisella cf. novicida Fx1] Length = 248 Score = 37.6 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R N++ ++ V I A + Sbjct: 1 MFIDTHCHLDFDIFDKIRQNILQNCNKLGVNYFINPATQ 39 >gi|78044788|ref|YP_361413.1| TatD family hydrolase [Carboxydothermus hydrogenoformans Z-2901] gi|77996903|gb|ABB15802.1| hydrolase, TatD family [Carboxydothermus hydrogenoformans Z-2901] Length = 254 Score = 37.6 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 20/36 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI++H H F +D VI RA Q V K+I + Sbjct: 1 MLIDSHAHLNDQKFKDDVEEVIKRARQNGVEKIITV 36 >gi|87125366|ref|ZP_01081212.1| TatD-related deoxyribonuclease [Synechococcus sp. RS9917] gi|86167135|gb|EAQ68396.1| TatD-related deoxyribonuclease [Synechococcus sp. RS9917] Length = 261 Score = 37.6 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + +FD+D V R A V+ ++ ++ Sbjct: 6 LIDSHCHIVFRNFDQDLDEVAQRWRDAGVVSLLHACVE 43 >gi|157962869|ref|YP_001502903.1| TatD-like deoxyribonuclease [Shewanella pealeana ATCC 700345] gi|157847869|gb|ABV88368.1| TatD-related deoxyribonuclease [Shewanella pealeana ATCC 700345] Length = 257 Score = 37.6 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 8/33 (24%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I++H H P+FD DR + ++ + ++ Sbjct: 4 IIDSHAHIDFPEFDNDRDALFLQMRSVGIENVL 36 >gi|320326077|gb|EFW82134.1| TatD family hydrolase [Pseudomonas syringae pv. glycinea str. B076] gi|320330243|gb|EFW86228.1| TatD family hydrolase [Pseudomonas syringae pv. glycinea str. race 4] Length = 266 Score = 37.6 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ V +++ + + Sbjct: 5 LIDTHTHLDFADFDADRAQVLDSCLSLGVQRIVVLGV 41 >gi|229513988|ref|ZP_04403450.1| hypothetical protein VCB_001633 [Vibrio cholerae TMA 21] gi|229349169|gb|EEO14126.1| hypothetical protein VCB_001633 [Vibrio cholerae TMA 21] Length = 283 Score = 37.6 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF P F + +A Q V +++ +I Sbjct: 22 LFDTHCHFDFPPFTATPELELQKAAQHGVKRLVVPSI 58 >gi|206889422|ref|YP_002249076.1| deoxyribonuclease, TatD family [Thermodesulfovibrio yellowstonii DSM 11347] gi|206741360|gb|ACI20417.1| deoxyribonuclease, TatD family [Thermodesulfovibrio yellowstonii DSM 11347] Length = 449 Score = 37.6 bits (86), Expect = 0.53, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I++HCH + F+E+ V+ RA+ A + +I I+ + Sbjct: 1 MIDSHCHLEM--FEEEISEVLKRAYDAGISTIITISSDI 37 >gi|260223255|emb|CBA33634.1| hypothetical protein Csp_B20040 [Curvibacter putative symbiont of Hydra magnipapillata] Length = 281 Score = 37.6 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 17/32 (53%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ++TH H P+FD DR V +A A V + Sbjct: 4 VDTHVHLDAPEFDADRSAVRQKARHAGVAHCV 35 >gi|212704388|ref|ZP_03312516.1| hypothetical protein DESPIG_02443 [Desulfovibrio piger ATCC 29098] gi|212672109|gb|EEB32592.1| hypothetical protein DESPIG_02443 [Desulfovibrio piger ATCC 29098] Length = 273 Score = 37.6 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ++H H +FD DR V+ RA A V + I Sbjct: 22 DSHAHLDGEEFDADREEVLARARAAGVATIGNI 54 >gi|298485532|ref|ZP_07003614.1| Putative deoxyribonuclease YjjV [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|298159932|gb|EFI00971.1| Putative deoxyribonuclease YjjV [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] Length = 264 Score = 37.6 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ V +++ + + Sbjct: 3 LIDTHTHLDFADFDADRAQVLDSCLSLGVQRIVVLGV 39 >gi|171463585|ref|YP_001797698.1| hydrolase, TatD family [Polynucleobacter necessarius subsp. necessarius STIR1] gi|171193123|gb|ACB44084.1| hydrolase, TatD family [Polynucleobacter necessarius subsp. necessarius STIR1] Length = 263 Score = 37.6 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 18/38 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I++HCH P+F V+ A V + +++ Sbjct: 1 MFIDSHCHLDFPEFQSRLPEVLANMQAAKVSHALCVSV 38 >gi|325281441|ref|YP_004253983.1| hydrolase, TatD family [Odoribacter splanchnicus DSM 20712] gi|324313250|gb|ADY33803.1| hydrolase, TatD family [Odoribacter splanchnicus DSM 20712] Length = 283 Score = 37.6 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+TH H +F EDR V+ RA +A V ++ Sbjct: 27 MYIDTHSHIYEEEFREDREAVVQRAREAGVNYIV 60 >gi|313900819|ref|ZP_07834309.1| hydrolase, TatD family [Clostridium sp. HGF2] gi|312954239|gb|EFR35917.1| hydrolase, TatD family [Clostridium sp. HGF2] Length = 255 Score = 37.6 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 18/37 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+THCH E V+ A QA + KM+ I Sbjct: 4 LIDTHCHITCDALYERIDEVLENARQAGIEKMLIICT 40 >gi|254780104|ref|YP_003058211.1| Deoxyribonuclease [Helicobacter pylori B38] gi|254002017|emb|CAX30276.1| Deoxyribonuclease [Helicobacter pylori B38] Length = 254 Score = 37.6 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 19/41 (46%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M I+THCH D++ D V+ + + V + + + Sbjct: 1 MFIDTHCHLDHRDYENDLEEVLKESLEKGVTQCVIPGTDMK 41 >gi|157368902|ref|YP_001476891.1| TatD-related deoxyribonuclease [Serratia proteamaculans 568] gi|157320666|gb|ABV39763.1| TatD-related deoxyribonuclease [Serratia proteamaculans 568] Length = 257 Score = 37.6 bits (86), Expect = 0.56, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 18/39 (46%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 +THCHF P F + A QA V ++I + R Sbjct: 6 DTHCHFDFPPFSGQERESLELAEQAGVRRIIVPTVTADR 44 >gi|295398234|ref|ZP_06808280.1| TatD family hydrolase [Aerococcus viridans ATCC 11563] gi|294973584|gb|EFG49365.1| TatD family hydrolase [Aerococcus viridans ATCC 11563] Length = 265 Score = 37.6 bits (86), Expect = 0.56, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVL 31 ML +TH H + DF++DR I RA A V Sbjct: 1 MLFDTHTHLNVDDFNDDRDETITRARHARVK 31 >gi|217031728|ref|ZP_03437232.1| hypothetical protein HPB128_155g41 [Helicobacter pylori B128] gi|298737135|ref|YP_003729665.1| Mg-dependent DNase [Helicobacter pylori B8] gi|216946575|gb|EEC25175.1| hypothetical protein HPB128_155g41 [Helicobacter pylori B128] gi|298356329|emb|CBI67201.1| Mg-dependent DNase [Helicobacter pylori B8] Length = 254 Score = 37.6 bits (86), Expect = 0.56, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|153217803|ref|ZP_01951434.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|124113302|gb|EAY32122.1| conserved hypothetical protein [Vibrio cholerae 1587] Length = 229 Score = 37.6 bits (86), Expect = 0.56, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKIL 33 >gi|71736160|ref|YP_273126.1| TatD family hydrolase [Pseudomonas syringae pv. phaseolicola 1448A] gi|71556713|gb|AAZ35924.1| hydrolase, TatD family [Pseudomonas syringae pv. phaseolicola 1448A] Length = 264 Score = 37.6 bits (86), Expect = 0.56, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ V +++ + + Sbjct: 3 LIDTHTHLDFADFDADRAQVLDSCLSLGVQRIVVLGV 39 >gi|317179774|dbj|BAJ57562.1| DNAse [Helicobacter pylori F30] Length = 254 Score = 37.6 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|312136820|ref|YP_004004157.1| hydrolase, tatd family [Methanothermus fervidus DSM 2088] gi|311224539|gb|ADP77395.1| hydrolase, TatD family [Methanothermus fervidus DSM 2088] Length = 248 Score = 37.6 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 +I+ HCH +F++DR VI RA + Sbjct: 1 MIDIHCHLDFKNFNKDREEVINRAKK 26 >gi|308183728|ref|YP_003927855.1| DNAse [Helicobacter pylori PeCan4] gi|308065913|gb|ADO07805.1| DNAse [Helicobacter pylori PeCan4] Length = 254 Score = 37.6 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|308062856|gb|ADO04744.1| DNAse [Helicobacter pylori Cuz20] Length = 254 Score = 37.6 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|261840266|gb|ACY00032.1| DNAse [Helicobacter pylori 52] Length = 254 Score = 37.6 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|261838860|gb|ACX98626.1| DNAse of the TatD family [Helicobacter pylori 51] Length = 254 Score = 37.6 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|15646180|ref|NP_208364.1| hypothetical protein HP1573 [Helicobacter pylori 26695] gi|2314758|gb|AAD08613.1| conserved hypothetical protein [Helicobacter pylori 26695] Length = 254 Score = 37.6 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|291288264|ref|YP_003505080.1| hydrolase, TatD family [Denitrovibrio acetiphilus DSM 12809] gi|290885424|gb|ADD69124.1| hydrolase, TatD family [Denitrovibrio acetiphilus DSM 12809] Length = 279 Score = 37.6 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 19/38 (50%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +THCH ++ +V RA + V +M+ + I + Sbjct: 29 DTHCHIHFSPLADELDDVSERAAERGVHRMVTVGIDLK 66 >gi|217033815|ref|ZP_03439240.1| hypothetical protein HP9810_877g19 [Helicobacter pylori 98-10] gi|216943713|gb|EEC23156.1| hypothetical protein HP9810_877g19 [Helicobacter pylori 98-10] Length = 254 Score = 37.6 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|39997584|ref|NP_953535.1| TatD family deoxyribonuclease [Geobacter sulfurreducens PCA] gi|39984476|gb|AAR35862.1| deoxyribonuclease, TatD family [Geobacter sulfurreducens PCA] Length = 462 Score = 37.6 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 11/42 (26%), Positives = 21/42 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 LI+TH H DF D ++ RA +A + ++ + + + Sbjct: 7 LIDTHAHIDGHDFAADFDAMLSRAWEAGLSHIVTVGADLESS 48 >gi|289209729|ref|YP_003461795.1| TatD-related deoxyribonuclease [Thioalkalivibrio sp. K90mix] gi|288945360|gb|ADC73059.1| TatD-related deoxyribonuclease [Thioalkalivibrio sp. K90mix] Length = 260 Score = 37.6 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+TH H L FD DR V+ RA A V +++ Sbjct: 3 LIDTHVHLDLDAFDPDRPAVLDRARAAGVQELV 35 >gi|171463258|ref|YP_001797371.1| TatD-related deoxyribonuclease [Polynucleobacter necessarius subsp. necessarius STIR1] gi|171192796|gb|ACB43757.1| TatD-related deoxyribonuclease [Polynucleobacter necessarius subsp. necessarius STIR1] Length = 244 Score = 37.6 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 23/40 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M I+THCH P+F + VI A + NV ++ A+KV Sbjct: 1 MWIDTHCHLDAPEFADSLPTVIRAAKEKNVKAILLPAVKV 40 >gi|298246066|ref|ZP_06969872.1| hydrolase, TatD family [Ktedonobacter racemifer DSM 44963] gi|297553547|gb|EFH87412.1| hydrolase, TatD family [Ktedonobacter racemifer DSM 44963] Length = 287 Score = 37.6 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +L ++H H + F EDR VI RA + V +MI Sbjct: 26 VLTDSHTHIDMSRFQEDREAVIQRAIEGGVTRMI 59 >gi|307635039|gb|ADI85246.2| magnesium-dependent deoxyribonuclease, TatD family, and radical SAM domain iron-sulfur oxidoreductase [Geobacter sulfurreducens KN400] Length = 462 Score = 37.6 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 11/42 (26%), Positives = 21/42 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 LI+TH H DF D ++ RA +A + ++ + + + Sbjct: 7 LIDTHAHIDGHDFAADFDAMLSRAWEAGLSHIVTVGADLESS 48 >gi|226939133|ref|YP_002794204.1| deoxyribonuclease [Laribacter hongkongensis HLHK9] gi|226714058|gb|ACO73196.1| Probable deoxyribonuclease [Laribacter hongkongensis HLHK9] Length = 257 Score = 37.6 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 I+THCH +FD DR V A A + +++ AI Sbjct: 3 FIDTHCHLDAREFDADRDQVAAAARAAGIRQLVVPAI 39 >gi|108563947|ref|YP_628263.1| hypothetical protein HPAG1_1522 [Helicobacter pylori HPAG1] gi|107837720|gb|ABF85589.1| DNAse [Helicobacter pylori HPAG1] Length = 254 Score = 37.6 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|330890676|gb|EGH23337.1| TatD family hydrolase [Pseudomonas syringae pv. mori str. 301020] Length = 266 Score = 37.6 bits (86), Expect = 0.61, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ V +++ + + Sbjct: 5 LIDTHTHLDFADFDADRAQVLDSCLSLGVQRIVVLGV 41 >gi|297582381|ref|YP_003698161.1| TatD family hydrolase [Bacillus selenitireducens MLS10] gi|297140838|gb|ADH97595.1| hydrolase, TatD family [Bacillus selenitireducens MLS10] Length = 261 Score = 37.6 bits (86), Expect = 0.61, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F++D V+ RA +A V +M+ + Sbjct: 1 MLFDTHVHLNADHFEDDLEEVLARAKEAGVDEMVVV 36 >gi|70727519|ref|YP_254435.1| TatD related DNase [Staphylococcus haemolyticus JCSC1435] gi|68448245|dbj|BAE05829.1| TatD related DNase [Staphylococcus haemolyticus JCSC1435] Length = 256 Score = 37.6 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 20/36 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H + ED VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYAEDLTEVISRAREAGVDRMFVV 36 >gi|317011810|gb|ADU85557.1| Deoxyribonuclease [Helicobacter pylori SouthAfrica7] Length = 254 Score = 37.6 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + Q V K + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLQESLQKGVSKCV 34 >gi|297662018|ref|XP_002809522.1| PREDICTED: putative deoxyribonuclease TATDN3-like [Pongo abelii] Length = 300 Score = 37.6 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKARK 33 >gi|229515860|ref|ZP_04405318.1| hypothetical protein VCB_003519 [Vibrio cholerae TMA 21] gi|229347123|gb|EEO12084.1| hypothetical protein VCB_003519 [Vibrio cholerae TMA 21] Length = 255 Score = 37.6 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARAKQVGIEKIL 33 >gi|210135751|ref|YP_002302190.1| DNAse of the TatD family [Helicobacter pylori P12] gi|210133719|gb|ACJ08710.1| DNAse of the TatD family [Helicobacter pylori P12] Length = 254 Score = 37.6 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|152992820|ref|YP_001358541.1| TatD family hydrolase [Sulfurovum sp. NBC37-1] gi|151424681|dbj|BAF72184.1| hydrolase, TatD family [Sulfurovum sp. NBC37-1] Length = 256 Score = 37.6 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+THCH +++D VI RA + +V K I Sbjct: 1 MIIDTHCHLDDTRYNDDLDEVIHRAEENSVEKFI 34 >gi|330880397|gb|EGH14546.1| TatD family hydrolase [Pseudomonas syringae pv. glycinea str. race 4] Length = 133 Score = 37.2 bits (85), Expect = 0.64, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ V +++ + + Sbjct: 5 LIDTHTHLDFADFDADRAQVLDSCLSLGVQRIVVLGV 41 >gi|317182798|dbj|BAJ60582.1| DNAse [Helicobacter pylori F57] Length = 258 Score = 37.2 bits (85), Expect = 0.64, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|307638260|gb|ADN80710.1| Putative deoxyribonuclease [Helicobacter pylori 908] gi|325996852|gb|ADZ52257.1| Putative deoxyribonuclease [Helicobacter pylori 2018] gi|325998444|gb|ADZ50652.1| Putative deoxyribonuclease [Helicobacter pylori 2017] Length = 254 Score = 37.2 bits (85), Expect = 0.64, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|332109431|gb|EGJ10354.1| putative deoxyribonuclease [Rubrivivax benzoatilyticus JA2] Length = 264 Score = 37.2 bits (85), Expect = 0.66, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 16/41 (39%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH P+ V+ A V + I + Sbjct: 1 MFVDSHCHLTFPELHGRVDAVLADMAAAGVHAALTICTTLE 41 >gi|293392973|ref|ZP_06637290.1| TatD family deoxyribonuclease [Serratia odorifera DSM 4582] gi|291424507|gb|EFE97719.1| TatD family deoxyribonuclease [Serratia odorifera DSM 4582] Length = 260 Score = 37.2 bits (85), Expect = 0.66, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 19/39 (48%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 +THCHF P F + + RA A V ++I + R Sbjct: 7 DTHCHFDFPPFAGNEAGSLQRAAAAGVQRIIVPTVTADR 45 >gi|153808870|ref|ZP_01961538.1| hypothetical protein BACCAC_03170 [Bacteroides caccae ATCC 43185] gi|149128696|gb|EDM19914.1| hypothetical protein BACCAC_03170 [Bacteroides caccae ATCC 43185] Length = 258 Score = 37.2 bits (85), Expect = 0.66, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 MLI+TH H L +F ED V+ RA +A V + Sbjct: 1 MLIDTHSHLFLEEFSEDLPQVMERARKAGVSHI 33 >gi|56478516|ref|YP_160105.1| Mg-dependent DNase [Aromatoleum aromaticum EbN1] gi|56314559|emb|CAI09204.1| Mg-dependent DNase [Aromatoleum aromaticum EbN1] Length = 257 Score = 37.2 bits (85), Expect = 0.66, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 18/41 (43%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH PD V+ V + +++K+ Sbjct: 1 MFVDSHCHLDFPDLAAREDAVLATMAANRVGHALCVSVKLE 41 >gi|332178181|gb|AEE13870.1| hydrolase, TatD family [Thermodesulfobium narugense DSM 14796] Length = 266 Score = 37.2 bits (85), Expect = 0.67, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 21/44 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTL 44 M ++H H FD DR +VI RA V MI + + +L Sbjct: 1 MFFDSHLHLESESFDSDREDVIKRAFDEQVGLMINVGSDLETSL 44 >gi|170703290|ref|ZP_02894085.1| TatD-related deoxyribonuclease [Burkholderia ambifaria IOP40-10] gi|170131800|gb|EDT00333.1| TatD-related deoxyribonuclease [Burkholderia ambifaria IOP40-10] Length = 262 Score = 37.2 bits (85), Expect = 0.67, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAAEFDADRDAVAQAARAAGVSRIV 34 >gi|254293991|ref|YP_003060014.1| hydrolase, TatD family [Hirschia baltica ATCC 49814] gi|254042522|gb|ACT59317.1| hydrolase, TatD family [Hirschia baltica ATCC 49814] Length = 260 Score = 37.2 bits (85), Expect = 0.67, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 L ++H + +DEDR V++RA +A V + I+I K+ Sbjct: 5 LFDSHINLHGEQYDEDREEVLLRAREAGVSRFISICDKLE 44 >gi|291225995|ref|XP_002732970.1| PREDICTED: Cell-death-Related Nuclease family member (crn-2)-like [Saccoglossus kowalevskii] Length = 273 Score = 37.2 bits (85), Expect = 0.68, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I+ HCH +FDED +VI RA + V ++A+A Sbjct: 7 IDCHCHIAAEEFDEDIDDVIKRAKENKVAGIVAVA 41 >gi|148642157|ref|YP_001272670.1| Mg-dependent DNase, TatD [Methanobrevibacter smithii ATCC 35061] gi|148551174|gb|ABQ86302.1| Mg-dependent DNase, TatD [Methanobrevibacter smithii ATCC 35061] Length = 253 Score = 37.2 bits (85), Expect = 0.68, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 18/26 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 +I+THCH D++ DR +VI RA + Sbjct: 1 MIDTHCHIDFEDYNNDRTDVIKRAKE 26 >gi|222444663|ref|ZP_03607178.1| hypothetical protein METSMIALI_00276 [Methanobrevibacter smithii DSM 2375] gi|222434228|gb|EEE41393.1| hypothetical protein METSMIALI_00276 [Methanobrevibacter smithii DSM 2375] Length = 253 Score = 37.2 bits (85), Expect = 0.69, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 19/26 (73%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 +I+THCH D++ DR +VI RA++ Sbjct: 1 MIDTHCHIDFEDYNNDRTDVIKRANE 26 >gi|167464616|ref|ZP_02329705.1| YabD [Paenibacillus larvae subsp. larvae BRL-230010] gi|322381207|ref|ZP_08055210.1| metal-dependent DNase-like protein [Paenibacillus larvae subsp. larvae B-3650] gi|321154783|gb|EFX47054.1| metal-dependent DNase-like protein [Paenibacillus larvae subsp. larvae B-3650] Length = 255 Score = 37.2 bits (85), Expect = 0.69, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+EDR VI RA + V +++ + Sbjct: 1 MLTDTHTHLNAEQFNEDRELVIQRALEQGVTRIVNV 36 >gi|148240399|ref|YP_001225786.1| Mg-dependent DNase [Synechococcus sp. WH 7803] gi|147848938|emb|CAK24489.1| Mg-dependent DNase [Synechococcus sp. WH 7803] Length = 261 Score = 37.2 bits (85), Expect = 0.69, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + +FD+D V R A V ++ ++ Sbjct: 6 LIDSHCHIVFRNFDDDLDAVAERWRDAGVTSLLHACVE 43 >gi|78223667|ref|YP_385414.1| TatD-related deoxyribonuclease:radical SAM family protein [Geobacter metallireducens GS-15] gi|78194922|gb|ABB32689.1| TatD-related deoxyribonuclease:Radical SAM [Geobacter metallireducens GS-15] Length = 606 Score = 37.2 bits (85), Expect = 0.69, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 LI+TH H DF D V+ RA +A + +I + + + Sbjct: 151 LIDTHAHIDGHDFVADFDEVLGRAAEAGLSHIITVGADLESS 192 >gi|118497330|ref|YP_898380.1| Mg-dependent DNase [Francisella tularensis subsp. novicida U112] gi|195536016|ref|ZP_03079023.1| hydrolase, TatD family [Francisella tularensis subsp. novicida FTE] gi|208779117|ref|ZP_03246463.1| hydrolase, TatD family [Francisella novicida FTG] gi|118423236|gb|ABK89626.1| Mg-dependent DNase [Francisella novicida U112] gi|194372493|gb|EDX27204.1| hydrolase, TatD family [Francisella tularensis subsp. novicida FTE] gi|208744917|gb|EDZ91215.1| hydrolase, TatD family [Francisella novicida FTG] Length = 248 Score = 37.2 bits (85), Expect = 0.70, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R N++ ++ + I A + Sbjct: 1 MFIDTHCHLDFDIFDKIRQNILQNCNKLGINYFINPATQ 39 >gi|127513746|ref|YP_001094943.1| TatD-related deoxyribonuclease [Shewanella loihica PV-4] gi|126639041|gb|ABO24684.1| TatD-related deoxyribonuclease [Shewanella loihica PV-4] Length = 276 Score = 37.2 bits (85), Expect = 0.70, Method: Composition-based stats. Identities = 7/33 (21%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I++H H +FD +R ++ R + + + Sbjct: 19 VIDSHVHLDFGEFDAERELLVERLKASGLKDAV 51 >gi|317178295|dbj|BAJ56084.1| DNAse [Helicobacter pylori F16] Length = 254 Score = 37.2 bits (85), Expect = 0.70, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|258510148|ref|YP_003183582.1| hydrolase, TatD family [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] gi|257476874|gb|ACV57193.1| hydrolase, TatD family [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 259 Score = 37.2 bits (85), Expect = 0.70, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCH + F +D +V+ RA +A V +++ A+ Sbjct: 3 LFDTHCHLMDGRFADDLDDVLARAREAGVERIVVPAV 39 >gi|198421633|ref|XP_002123991.1| PREDICTED: similar to TatD DNase domain containing 3 [Ciona intestinalis] Length = 272 Score = 37.2 bits (85), Expect = 0.70, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 21/35 (60%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I+ HCH +F+ DRH VI RA ANV +I + Sbjct: 9 IDCHCHLSCTEFNVDRHKVIERAKAANVQAIIIVT 43 >gi|149189878|ref|ZP_01868158.1| hypothetical protein VSAK1_13200 [Vibrio shilonii AK1] gi|148836364|gb|EDL53321.1| hypothetical protein VSAK1_13200 [Vibrio shilonii AK1] Length = 253 Score = 37.2 bits (85), Expect = 0.71, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA A + ++ Sbjct: 1 MIDTHAHIYATEFDNDRDEVVQRARAAGIEHIL 33 >gi|89101165|ref|ZP_01173998.1| YabD [Bacillus sp. NRRL B-14911] gi|89084133|gb|EAR63301.1| YabD [Bacillus sp. NRRL B-14911] Length = 256 Score = 37.2 bits (85), Expect = 0.71, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI RA V M+ + Sbjct: 1 MLFDTHVHLNAEQFEEDLEEVIGRAQAEGVSHMVVV 36 >gi|224419114|ref|ZP_03657120.1| TatD family hydrolase [Helicobacter canadensis MIT 98-5491] gi|253828050|ref|ZP_04870935.1| putative Mg-dependent DNase [Helicobacter canadensis MIT 98-5491] gi|313142621|ref|ZP_07804814.1| hydrolase [Helicobacter canadensis MIT 98-5491] gi|253511456|gb|EES90115.1| putative Mg-dependent DNase [Helicobacter canadensis MIT 98-5491] gi|313131652|gb|EFR49269.1| hydrolase [Helicobacter canadensis MIT 98-5491] Length = 263 Score = 37.2 bits (85), Expect = 0.72, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCH F+ED ++ RA A + + I Sbjct: 3 LCDTHCHLDDKRFEEDFEAILDRARNAGITRFI 35 >gi|307721072|ref|YP_003892212.1| hydrolase, TatD family [Sulfurimonas autotrophica DSM 16294] gi|306979165|gb|ADN09200.1| hydrolase, TatD family [Sulfurimonas autotrophica DSM 16294] Length = 258 Score = 37.2 bits (85), Expect = 0.72, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+TH H +DED + V+ RA + V + I Sbjct: 1 MIIDTHIHLDDARYDEDLNAVLGRAREGGVKRFI 34 >gi|261211459|ref|ZP_05925747.1| putative deoxyribonuclease YjjV [Vibrio sp. RC341] gi|260839414|gb|EEX66040.1| putative deoxyribonuclease YjjV [Vibrio sp. RC341] Length = 271 Score = 37.2 bits (85), Expect = 0.73, Method: Composition-based stats. Identities = 10/37 (27%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF F + + RA + V +++ ++ Sbjct: 10 LFDTHCHFDFAPFTAEPELELQRAAEQGVQRLLVPSV 46 >gi|261350797|ref|ZP_05976214.1| TatD-related deoxyribonuclease [Methanobrevibacter smithii DSM 2374] gi|288860415|gb|EFC92713.1| TatD-related deoxyribonuclease [Methanobrevibacter smithii DSM 2374] Length = 253 Score = 37.2 bits (85), Expect = 0.73, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 18/26 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 +I+THCH D++ DR +VI RA + Sbjct: 1 MIDTHCHIDFEDYNNDRTDVIKRAKE 26 >gi|317013388|gb|ADU83996.1| hypothetical protein HPLT_08125 [Helicobacter pylori Lithuania75] Length = 254 Score = 37.2 bits (85), Expect = 0.75, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHRDYENDLEEVLKESLEKGVTQCV 34 >gi|325524448|gb|EGD02514.1| TatD-related deoxyribonuclease [Burkholderia sp. TJI49] Length = 262 Score = 37.2 bits (85), Expect = 0.76, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 21/38 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V A A V +++ +I Sbjct: 1 MWIDTHCHLDAAEFDADRDAVAHAARAAGVSRIVIPSI 38 >gi|260434480|ref|ZP_05788450.1| Sec-independent protein translocase TatD [Synechococcus sp. WH 8109] gi|260412354|gb|EEX05650.1| Sec-independent protein translocase TatD [Synechococcus sp. WH 8109] Length = 256 Score = 37.2 bits (85), Expect = 0.76, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 +I++HCH + +FD+D V +R +A V ++ ++ Sbjct: 1 MIDSHCHIVFRNFDDDLDEVALRWREAGVGALLHACVE 38 >gi|257868860|ref|ZP_05648513.1| hydrolase [Enterococcus gallinarum EG2] gi|257803024|gb|EEV31846.1| hydrolase [Enterococcus gallinarum EG2] Length = 257 Score = 37.2 bits (85), Expect = 0.76, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M+ ++H H F+E+ I RAH+ V KM + Sbjct: 1 MIFDSHTHLNAEQFNEEIPETIARAHELGVTKMAVV 36 >gi|325124525|gb|ADY84048.1| conserved hypothetical protein; putative enzyme [Acinetobacter calcoaceticus PHEA-2] Length = 270 Score = 37.2 bits (85), Expect = 0.77, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFDEDR + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRQQLALEAKKVGVDALVLI 37 >gi|299771569|ref|YP_003733595.1| Putative deoxyribonuclease yjjV [Acinetobacter sp. DR1] gi|298701657|gb|ADI92222.1| Putative deoxyribonuclease yjjV [Acinetobacter sp. DR1] Length = 270 Score = 37.2 bits (85), Expect = 0.78, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFDEDR + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRQQLALNAKKVGVDALVLI 37 >gi|189461914|ref|ZP_03010699.1| hypothetical protein BACCOP_02580 [Bacteroides coprocola DSM 17136] gi|189431308|gb|EDV00293.1| hypothetical protein BACCOP_02580 [Bacteroides coprocola DSM 17136] Length = 262 Score = 37.2 bits (85), Expect = 0.78, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 21/32 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 LI+TH H +FDEDR I+RA +A V ++ Sbjct: 4 LIDTHTHLFAEEFDEDRELAIIRATEAGVTRL 35 >gi|261210186|ref|ZP_05924483.1| deoxyribonuclease TatD [Vibrio sp. RC341] gi|260840726|gb|EEX67275.1| deoxyribonuclease TatD [Vibrio sp. RC341] Length = 255 Score = 37.2 bits (85), Expect = 0.78, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA QA + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDAVMERAKQAGIEKIL 33 >gi|254421269|ref|ZP_05034987.1| hydrolase, TatD family [Synechococcus sp. PCC 7335] gi|196188758|gb|EDX83722.1| hydrolase, TatD family [Synechococcus sp. PCC 7335] Length = 265 Score = 37.2 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L++TH H FD DR +V +A V ++ + Sbjct: 3 LVDTHVHINFDSFDVDRDDVAAAWREAGVAHLVHSCV 39 >gi|297380748|gb|ADI35635.1| hydrolase, TatD family [Helicobacter pylori v225d] Length = 254 Score = 37.2 bits (85), Expect = 0.81, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M ++THCH D++ D V+ + + V + + Sbjct: 1 MFVDTHCHLDHKDYENDLEEVLKESLEKGVTQCV 34 >gi|221045074|dbj|BAH14214.1| unnamed protein product [Homo sapiens] Length = 253 Score = 37.2 bits (85), Expect = 0.81, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|109948154|ref|YP_665382.1| hypothetical protein Hac_1680 [Helicobacter acinonychis str. Sheeba] gi|109715375|emb|CAK00383.1| unnamed protein product [Helicobacter acinonychis str. Sheeba] Length = 254 Score = 37.2 bits (85), Expect = 0.81, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V K + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVSKCV 34 >gi|317181275|dbj|BAJ59061.1| DNAse [Helicobacter pylori F32] Length = 254 Score = 36.9 bits (84), Expect = 0.83, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHRDYENDLEEVLKESLEKGVTQCV 34 >gi|308185360|ref|YP_003929493.1| Deoxyribonuclease [Helicobacter pylori SJM180] gi|308061280|gb|ADO03176.1| Deoxyribonuclease [Helicobacter pylori SJM180] Length = 254 Score = 36.9 bits (84), Expect = 0.83, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHRDYENDLEEVLKESLEKGVTQCV 34 >gi|255691321|ref|ZP_05414996.1| hydrolase, TatD family [Bacteroides finegoldii DSM 17565] gi|260622963|gb|EEX45834.1| hydrolase, TatD family [Bacteroides finegoldii DSM 17565] Length = 258 Score = 36.9 bits (84), Expect = 0.83, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 MLI+TH H L +F ED V+ RA A V + Sbjct: 1 MLIDTHSHLFLEEFAEDLPQVMERARNAGVSSI 33 >gi|290967765|ref|ZP_06559318.1| hydrolase, TatD family [Megasphaera genomosp. type_1 str. 28L] gi|290782124|gb|EFD94699.1| hydrolase, TatD family [Megasphaera genomosp. type_1 str. 28L] Length = 255 Score = 36.9 bits (84), Expect = 0.84, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+ +THCH +D DR VI RA A V M+ Sbjct: 1 MVFDTHCHIHDEAYDSDREAVIRRAFAAGVQYMM 34 >gi|121591870|ref|ZP_01679039.1| hydrolase, TatD family [Vibrio cholerae 2740-80] gi|121546265|gb|EAX56563.1| hydrolase, TatD family [Vibrio cholerae 2740-80] Length = 142 Score = 36.9 bits (84), Expect = 0.84, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASEFDHDRDEVIARARQVGIEKIL 33 >gi|254874692|ref|ZP_05247402.1| tatD, hydrolase [Francisella tularensis subsp. tularensis MA00-2987] gi|254840691|gb|EET19127.1| tatD, hydrolase [Francisella tularensis subsp. tularensis MA00-2987] Length = 170 Score = 36.9 bits (84), Expect = 0.85, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R N++ ++ V I A + Sbjct: 1 MFIDTHCHLDFDIFDKTRQNILQNCNKLGVNYFINPATQ 39 >gi|119897988|ref|YP_933201.1| putative deoxyribonuclease [Azoarcus sp. BH72] gi|119670401|emb|CAL94314.1| putative deoxyribonuclease [Azoarcus sp. BH72] Length = 273 Score = 36.9 bits (84), Expect = 0.85, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 20/39 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 L++TH H +FD DR V A +A V + A+ V Sbjct: 16 LVDTHIHLDAAEFDADRAEVAQAARKAGVSCFVVPAVDV 54 >gi|325982160|ref|YP_004294562.1| hydrolase, TatD family [Nitrosomonas sp. AL212] gi|325531679|gb|ADZ26400.1| hydrolase, TatD family [Nitrosomonas sp. AL212] Length = 260 Score = 36.9 bits (84), Expect = 0.86, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 21/41 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M I++HCH PD +D +++ + V + +++ + Sbjct: 1 MFIDSHCHLDFPDLAKDLDQLLVNMQENQVTHALCVSVNLR 41 >gi|326796535|ref|YP_004314355.1| TatD-related deoxyribonuclease [Marinomonas mediterranea MMB-1] gi|326547299|gb|ADZ92519.1| TatD-related deoxyribonuclease [Marinomonas mediterranea MMB-1] Length = 261 Score = 36.9 bits (84), Expect = 0.87, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 19/39 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I++HCH FD DR +++ V ++ + V Sbjct: 9 MIDSHCHLDFQVFDRDRESIVQTCLSLGVDGLLVPSTTV 47 >gi|255021624|ref|ZP_05293667.1| Putative deoxyribonuclease YjjV [Acidithiobacillus caldus ATCC 51756] gi|254969012|gb|EET26531.1| Putative deoxyribonuclease YjjV [Acidithiobacillus caldus ATCC 51756] Length = 260 Score = 36.9 bits (84), Expect = 0.87, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I++HCHF P F DR V RA A V +I Sbjct: 5 IIDSHCHFDAPAFAPDRAQVWNRAVAAGVDALI 37 >gi|229527152|ref|ZP_04416546.1| hypothetical protein VCG_000217 [Vibrio cholerae 12129(1)] gi|229335383|gb|EEO00866.1| hypothetical protein VCG_000217 [Vibrio cholerae 12129(1)] gi|327483007|gb|AEA77414.1| Putative deoxyribonuclease YcfH-like protein, type 2 [Vibrio cholerae LMA3894-4] Length = 255 Score = 36.9 bits (84), Expect = 0.87, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H FD DR VI RA Q + K++ Sbjct: 1 MIDTHAHVYASAFDHDRDEVIARARQVGIEKIL 33 >gi|288574651|ref|ZP_06393008.1| hydrolase, TatD family [Dethiosulfovibrio peptidovorans DSM 11002] gi|288570392|gb|EFC91949.1| hydrolase, TatD family [Dethiosulfovibrio peptidovorans DSM 11002] Length = 261 Score = 36.9 bits (84), Expect = 0.87, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 18/41 (43%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 I+ HCH P+ + I A A V +M+ + + + Sbjct: 5 IDGHCHLNSPELRGELDRHIDEARSAGVQRMLVVGTDLRTS 45 >gi|226061614|ref|NP_001139642.1| putative deoxyribonuclease TATDN3 isoform 4 [Homo sapiens] Length = 253 Score = 36.9 bits (84), Expect = 0.88, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|308064355|gb|ADO06242.1| DNAse [Helicobacter pylori Sat464] Length = 254 Score = 36.9 bits (84), Expect = 0.89, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHRDYENDLEEVLKESLEKGVTQCV 34 >gi|262374225|ref|ZP_06067501.1| conserved hypothetical protein [Acinetobacter junii SH205] gi|262310783|gb|EEY91871.1| conserved hypothetical protein [Acinetobacter junii SH205] Length = 271 Score = 36.9 bits (84), Expect = 0.89, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFD DR + ++A Q V ++ I Sbjct: 3 LFDTHTHFDVADFDHDRQQLAIQAKQVGVEALVLI 37 >gi|114776938|ref|ZP_01451981.1| hypothetical protein SPV1_12001 [Mariprofundus ferrooxydans PV-1] gi|114553024|gb|EAU55455.1| hypothetical protein SPV1_12001 [Mariprofundus ferrooxydans PV-1] Length = 250 Score = 36.9 bits (84), Expect = 0.89, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANV 30 LI++HCH FD+DR ++ RA + Sbjct: 3 LIDSHCHLDDVRFDQDRDIILARAADHGI 31 >gi|326335796|ref|ZP_08201976.1| TatD family deoxyribonuclease [Capnocytophaga sp. oral taxon 338 str. F0234] gi|325692035|gb|EGD33994.1| TatD family deoxyribonuclease [Capnocytophaga sp. oral taxon 338 str. F0234] Length = 256 Score = 36.9 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 20/32 (62%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 M+I+TH H + DFD D V++RA + + + Sbjct: 1 MIIDTHTHLYVEDFDTDYQEVVLRAMEQGIKQ 32 >gi|315583405|pdb|2Y1H|A Chain A, Crystal Structure Of The Human Tatd-Domain Protein 3 (Tatdn3) gi|315583406|pdb|2Y1H|B Chain B, Crystal Structure Of The Human Tatd-Domain Protein 3 (Tatdn3) Length = 272 Score = 36.9 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 6 LVDCHCHLSAPDFDRDLDDVLEKAKK 31 >gi|169634377|ref|YP_001708113.1| hypothetical protein ABSDF2965 [Acinetobacter baumannii SDF] gi|169153169|emb|CAP02254.1| conserved hypothetical protein [Acinetobacter baumannii] Length = 270 Score = 36.9 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFDEDR + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRQQLALEAKKVGVDALVLI 37 >gi|86609899|ref|YP_478661.1| TatD family hydrolase [Synechococcus sp. JA-2-3B'a(2-13)] gi|86558441|gb|ABD03398.1| hydrolase, TatD family [Synechococcus sp. JA-2-3B'a(2-13)] Length = 259 Score = 36.9 bits (84), Expect = 0.90, Method: Composition-based stats. Identities = 10/36 (27%), Positives = 17/36 (47%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ++TH H PDF D V R Q + +++ + Sbjct: 1 MDTHVHLNYPDFAADLPQVAERWRQTGIRRLVHSCV 36 >gi|208435452|ref|YP_002267118.1| DNAse [Helicobacter pylori G27] gi|208433381|gb|ACI28252.1| DNAse [Helicobacter pylori G27] Length = 254 Score = 36.9 bits (84), Expect = 0.91, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHRDYENDLEEVLKESLEKGVTQCV 34 >gi|207092007|ref|ZP_03239794.1| hypothetical protein HpylHP_02923 [Helicobacter pylori HPKX_438_AG0C1] Length = 254 Score = 36.9 bits (84), Expect = 0.91, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHRDYENDLEEVLKESLEKGVTQCV 34 >gi|188528365|ref|YP_001911052.1| DNAse [Helicobacter pylori Shi470] gi|188144605|gb|ACD49022.1| DNAse [Helicobacter pylori Shi470] Length = 254 Score = 36.9 bits (84), Expect = 0.91, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHRDYENDLEEVLKESLEKGVTQCV 34 >gi|71980746|ref|NP_493691.2| hypothetical protein B0432.8 [Caenorhabditis elegans] gi|32699261|gb|AAB37894.2| Hypothetical protein B0432.8 [Caenorhabditis elegans] Length = 259 Score = 36.9 bits (84), Expect = 0.91, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+ HCH + F ED +VI AH + KMI Sbjct: 1 MIDVHCHLVDNKFKEDLDDVIGHAHATGIQKMI 33 >gi|262166409|ref|ZP_06034146.1| putative deoxyribonuclease YjjV [Vibrio mimicus VM223] gi|262026125|gb|EEY44793.1| putative deoxyribonuclease YjjV [Vibrio mimicus VM223] Length = 271 Score = 36.9 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCHF F + + RA + V +++ Sbjct: 10 LFDTHCHFDFAPFTAEPELELQRAAEQGVKRLL 42 >gi|163802207|ref|ZP_02196102.1| sec-independent translocase [Vibrio sp. AND4] gi|159174012|gb|EDP58822.1| sec-independent translocase [Vibrio sp. AND4] Length = 254 Score = 36.9 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FDEDR V+ RA + + +++ Sbjct: 1 MIDTHAHIYASEFDEDRDQVVKRAREQGIDRIL 33 >gi|260596385|ref|YP_003208956.1| deoxyribonuclease YjjV [Cronobacter turicensis z3032] gi|260215562|emb|CBA27770.1| Uncharacterized deoxyribonuclease yjjV [Cronobacter turicensis z3032] Length = 261 Score = 36.9 bits (84), Expect = 0.95, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 20/41 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F + +A A V +I AI+ R Sbjct: 5 FIDTHCHFDFPPFTGAETESLAQAASAGVEHIIVPAIEAAR 45 >gi|271499069|ref|YP_003332094.1| TatD-like deoxyribonuclease [Dickeya dadantii Ech586] gi|270342624|gb|ACZ75389.1| TatD-related deoxyribonuclease [Dickeya dadantii Ech586] Length = 289 Score = 36.9 bits (84), Expect = 0.95, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F +D + +A QA V ++I Sbjct: 34 FIDTHCHFDFPLFADDAAGSLAQAGQAGVHRLI 66 >gi|159897492|ref|YP_001543739.1| TatD family hydrolase [Herpetosiphon aurantiacus ATCC 23779] gi|159890531|gb|ABX03611.1| hydrolase, TatD family [Herpetosiphon aurantiacus ATCC 23779] Length = 256 Score = 36.9 bits (84), Expect = 0.95, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 22/36 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H FD+DR V RA A+V +MI I Sbjct: 1 MLIDTHTHVHSDQFDDDRAAVFERAQAADVTRMINI 36 >gi|325272935|ref|ZP_08139257.1| TatD family deoxyribonuclease [Pseudomonas sp. TJI-51] gi|324101924|gb|EGB99448.1| TatD family deoxyribonuclease [Pseudomonas sp. TJI-51] Length = 158 Score = 36.9 bits (84), Expect = 0.96, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H PDFD DR ++ A V +M+ + + Sbjct: 3 LIDTHTHLDFPDFDADRARLLANAAARGVERMVVLGV 39 >gi|323438723|gb|EGA96463.1| sec-independent hydrolase [Staphylococcus aureus O11] Length = 257 Score = 36.9 bits (84), Expect = 0.96, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 20/36 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H +D+D VI RA +A V +M + Sbjct: 1 MLTDTHVHLNDEQYDDDLSEVITRAREAGVDRMFVV 36 >gi|298507316|gb|ADI86039.1| magnesium-dependent deoxyribonuclease, TatD family [Geobacter sulfurreducens KN400] Length = 255 Score = 36.9 bits (84), Expect = 0.96, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ML +THCH P V+ A A V ++I Sbjct: 1 MLTDTHCHLDAPPLRGRLDEVLASARHAGVDRII 34 >gi|213513143|ref|NP_001134578.1| deoxyribonuclease tatdn3 [Salmo salar] gi|209734426|gb|ACI68082.1| deoxyribonuclease tatdn3 [Salmo salar] Length = 272 Score = 36.9 bits (84), Expect = 0.97, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 20/36 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ++ HCH +F ED +VI R +A V +I++ Sbjct: 8 FVDCHCHITAYEFAEDLEDVIKRTREAGVKTLISVT 43 >gi|224475633|ref|YP_002633239.1| putative TatD-related deoxyribonuclease [Staphylococcus carnosus subsp. carnosus TM300] gi|222420240|emb|CAL27054.1| putative TatD-related deoxyribonuclease [Staphylococcus carnosus subsp. carnosus TM300] Length = 257 Score = 36.9 bits (84), Expect = 0.97, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +DED VI RA +A V +M + Sbjct: 1 MLIDTHVHLNDEQYDEDLEEVIDRAREARVDRMFVV 36 >gi|218961554|ref|YP_001741329.1| Mg-dependent DNase [Candidatus Cloacamonas acidaminovorans] gi|167730211|emb|CAO81123.1| Mg-dependent DNase [Candidatus Cloacamonas acidaminovorans] Length = 266 Score = 36.9 bits (84), Expect = 0.98, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 19/36 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 L TH H PDFD DR +I + + + +I +A Sbjct: 3 LFETHAHLDHPDFDADRETIINKCFSSGIEYIINVA 38 >gi|255746967|ref|ZP_05420912.1| putative deoxyribonuclease YjjV [Vibrio cholera CIRS 101] gi|262161489|ref|ZP_06030599.1| putative deoxyribonuclease YjjV [Vibrio cholerae INDRE 91/1] gi|262168341|ref|ZP_06036038.1| putative deoxyribonuclease YjjV [Vibrio cholerae RC27] gi|255735369|gb|EET90769.1| putative deoxyribonuclease YjjV [Vibrio cholera CIRS 101] gi|262023233|gb|EEY41937.1| putative deoxyribonuclease YjjV [Vibrio cholerae RC27] gi|262028800|gb|EEY47454.1| putative deoxyribonuclease YjjV [Vibrio cholerae INDRE 91/1] Length = 274 Score = 36.9 bits (84), Expect = 0.99, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF P F + +A Q V +++ +I Sbjct: 13 LFDTHCHFDFPPFTATPELELQKAAQHGVRRLVVPSI 49 >gi|71052092|gb|AAH48115.1| TATDN3 protein [Homo sapiens] Length = 275 Score = 36.9 bits (84), Expect = 0.99, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 9 LVDCHCHLSAPDFDRDLDDVLEKAKK 34 >gi|226061853|ref|NP_001139643.1| putative deoxyribonuclease TATDN3 isoform 5 [Homo sapiens] gi|119613782|gb|EAW93376.1| hCG1782642, isoform CRA_a [Homo sapiens] Length = 281 Score = 36.9 bits (84), Expect = 1.00, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|110349730|ref|NP_001036017.1| putative deoxyribonuclease TATDN3 isoform 1 [Homo sapiens] gi|121948822|sp|Q17R31|TATD3_HUMAN RecName: Full=Putative deoxyribonuclease TATDN3 gi|109658640|gb|AAI17486.1| TatD DNase domain containing 3 [Homo sapiens] gi|109730573|gb|AAI13639.1| TatD DNase domain containing 3 [Homo sapiens] gi|119613783|gb|EAW93377.1| hCG1782642, isoform CRA_b [Homo sapiens] gi|313882858|gb|ADR82915.1| TatD DNase domain containing 3 [synthetic construct] Length = 274 Score = 36.9 bits (84), Expect = 1.00, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|296230152|ref|XP_002760584.1| PREDICTED: putative deoxyribonuclease TATDN3-like isoform 3 [Callithrix jacchus] Length = 253 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|327484855|gb|AEA79262.1| Putative deoxyribonuclease YjjV [Vibrio cholerae LMA3894-4] Length = 274 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF P F + +A Q V +++ +I Sbjct: 13 LFDTHCHFDFPPFTATPELELQKAAQHGVRRLVVPSI 49 >gi|300715195|ref|YP_003739998.1| Mg-dependent DNase [Erwinia billingiae Eb661] gi|299061031|emb|CAX58138.1| Mg-dependent DNase [Erwinia billingiae Eb661] Length = 258 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 19/41 (46%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF F + + A A V K+I + + R Sbjct: 5 FIDTHCHFDFAPFSGNEEESLRLAAAAGVEKIIVVGVSADR 45 >gi|224025694|ref|ZP_03644060.1| hypothetical protein BACCOPRO_02435 [Bacteroides coprophilus DSM 18228] gi|224018930|gb|EEF76928.1| hypothetical protein BACCOPRO_02435 [Bacteroides coprophilus DSM 18228] Length = 262 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 21/32 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 LI+TH H +FDEDR ++RA +A V ++ Sbjct: 4 LIDTHTHLFAEEFDEDRELAVLRAGEAGVTRL 35 >gi|330982754|gb|EGH80857.1| TatD family hydrolase [Pseudomonas syringae pv. aptata str. DSM 50252] Length = 49 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ V +M+ + + Sbjct: 5 LIDTHTHLDFADFDADRAQVLDNCLALGVQRMVVLGV 41 >gi|110349734|ref|NP_001036018.1| putative deoxyribonuclease TATDN3 isoform 2 [Homo sapiens] gi|119613784|gb|EAW93378.1| hCG1782642, isoform CRA_c [Homo sapiens] gi|219518074|gb|AAI43957.1| TatD DNase domain containing 3 [Homo sapiens] Length = 273 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|270263861|ref|ZP_06192129.1| TatD-related deoxyribonuclease [Serratia odorifera 4Rx13] gi|270042054|gb|EFA15150.1| TatD-related deoxyribonuclease [Serratia odorifera 4Rx13] Length = 258 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 18/39 (46%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 +THCHF P F + A QA V ++I + R Sbjct: 7 DTHCHFDFPPFSGHESESLALAEQAGVQRIIVPTVTADR 45 >gi|223039855|ref|ZP_03610139.1| hydrolase, TatD family [Campylobacter rectus RM3267] gi|222878864|gb|EEF13961.1| hydrolase, TatD family [Campylobacter rectus RM3267] Length = 261 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVL 31 M+I+THCH FD D VI A + V Sbjct: 1 MIIDTHCHLDDKSFDNDIAQVIANARENGVG 31 >gi|157376513|ref|YP_001475113.1| TatD-related deoxyribonuclease [Shewanella sediminis HAW-EB3] gi|157318887|gb|ABV37985.1| TatD-related deoxyribonuclease [Shewanella sediminis HAW-EB3] Length = 278 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I++H H P+FD DR V A + I Sbjct: 25 MIDSHAHLDFPEFDIDREQVFDAMRSAGIESAI 57 >gi|78184181|ref|YP_376616.1| TatD-related deoxyribonuclease [Synechococcus sp. CC9902] gi|78168475|gb|ABB25572.1| TatD-related deoxyribonuclease [Synechococcus sp. CC9902] Length = 262 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 21/38 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + +F+ED V R A V ++ ++ Sbjct: 7 LIDSHCHIVFRNFEEDLDEVATRWRDAGVRALLHACVE 44 >gi|71909452|ref|YP_287039.1| TatD-related deoxyribonuclease [Dechloromonas aromatica RCB] gi|71849073|gb|AAZ48569.1| TatD-related deoxyribonuclease [Dechloromonas aromatica RCB] Length = 253 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 12/21 (57%), Positives = 14/21 (66%) Query: 1 MLINTHCHFLLPDFDEDRHNV 21 MLI+THCH +FD DR V Sbjct: 1 MLIDTHCHLDAAEFDADRDRV 21 >gi|322834514|ref|YP_004214541.1| TatD-related deoxyribonuclease [Rahnella sp. Y9602] gi|321169715|gb|ADW75414.1| TatD-related deoxyribonuclease [Rahnella sp. Y9602] Length = 261 Score = 36.9 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 20/41 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++THCHF P F + A +A V ++I A+ R Sbjct: 5 FVDTHCHFDFPPFTGAETESLRLAAEAGVGQIIVPAVTSDR 45 >gi|262170691|ref|ZP_06038369.1| putative deoxyribonuclease YjjV [Vibrio mimicus MB-451] gi|261891767|gb|EEY37753.1| putative deoxyribonuclease YjjV [Vibrio mimicus MB-451] Length = 271 Score = 36.9 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCHF F + + RA + V +++ Sbjct: 10 LFDTHCHFDFAPFTAEPELELQRAAEQGVKRLL 42 >gi|114572522|ref|XP_001170542.1| PREDICTED: TatD DNase domain containing 3 isoform 1 [Pan troglodytes] Length = 274 Score = 36.9 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|55589294|ref|XP_514184.1| PREDICTED: TatD DNase domain containing 3 isoform 2 [Pan troglodytes] Length = 281 Score = 36.9 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|221039388|dbj|BAH11457.1| unnamed protein product [Homo sapiens] Length = 281 Score = 36.9 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|15642350|ref|NP_231983.1| hypothetical protein VC2353 [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121591298|ref|ZP_01678592.1| conserved hypothetical protein [Vibrio cholerae 2740-80] gi|147674354|ref|YP_001217856.1| hypothetical protein VC0395_A1932 [Vibrio cholerae O395] gi|153819762|ref|ZP_01972429.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] gi|227082477|ref|YP_002811028.1| Putative deoxyribonuclease yjjV [Vibrio cholerae M66-2] gi|229507581|ref|ZP_04397086.1| hypothetical protein VCF_002810 [Vibrio cholerae BX 330286] gi|229512223|ref|ZP_04401702.1| hypothetical protein VCE_003635 [Vibrio cholerae B33] gi|229519359|ref|ZP_04408802.1| hypothetical protein VCC_003389 [Vibrio cholerae RC9] gi|229607087|ref|YP_002877735.1| hypothetical protein VCD_001996 [Vibrio cholerae MJ-1236] gi|254849475|ref|ZP_05238825.1| conserved hypothetical protein [Vibrio cholerae MO10] gi|297580984|ref|ZP_06942909.1| conserved hypothetical protein [Vibrio cholerae RC385] gi|298500285|ref|ZP_07010090.1| conserved hypothetical protein [Vibrio cholerae MAK 757] gi|9656921|gb|AAF95496.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121546857|gb|EAX57017.1| conserved hypothetical protein [Vibrio cholerae 2740-80] gi|126509688|gb|EAZ72282.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] gi|146316237|gb|ABQ20776.1| conserved hypothetical protein [Vibrio cholerae O395] gi|227010365|gb|ACP06577.1| Putative deoxyribonuclease yjjV [Vibrio cholerae M66-2] gi|227014248|gb|ACP10458.1| Putative deoxyribonuclease yjjV [Vibrio cholerae O395] gi|229344048|gb|EEO09023.1| hypothetical protein VCC_003389 [Vibrio cholerae RC9] gi|229352188|gb|EEO17129.1| hypothetical protein VCE_003635 [Vibrio cholerae B33] gi|229355086|gb|EEO20007.1| hypothetical protein VCF_002810 [Vibrio cholerae BX 330286] gi|229369742|gb|ACQ60165.1| hypothetical protein VCD_001996 [Vibrio cholerae MJ-1236] gi|254845180|gb|EET23594.1| conserved hypothetical protein [Vibrio cholerae MO10] gi|297534810|gb|EFH73646.1| conserved hypothetical protein [Vibrio cholerae RC385] gi|297540978|gb|EFH77032.1| conserved hypothetical protein [Vibrio cholerae MAK 757] Length = 283 Score = 36.9 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF P F + +A Q V +++ +I Sbjct: 22 LFDTHCHFDFPPFTATPELELQKAAQHGVRRLVVPSI 58 >gi|327403704|ref|YP_004344542.1| TatD family hydrolase [Fluviicola taffensis DSM 16823] gi|327319212|gb|AEA43704.1| hydrolase, TatD family [Fluviicola taffensis DSM 16823] Length = 255 Score = 36.9 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 M I+TH H F+EDR +I RA A V +M Sbjct: 1 MFIDTHTHLYSEQFNEDRTEMIQRAIAAGVERM 33 >gi|226061595|ref|NP_001139641.1| putative deoxyribonuclease TATDN3 isoform 3 [Homo sapiens] Length = 240 Score = 36.9 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|239500735|ref|ZP_04660045.1| Putative deoxyribonuclease yjjV [Acinetobacter baumannii AB900] Length = 270 Score = 36.5 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFDEDR + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRQQLALEAKKVGVDALVLI 37 >gi|229524345|ref|ZP_04413750.1| hypothetical protein VCA_001935 [Vibrio cholerae bv. albensis VL426] gi|229337926|gb|EEO02943.1| hypothetical protein VCA_001935 [Vibrio cholerae bv. albensis VL426] Length = 283 Score = 36.5 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF P F + +A Q V +++ +I Sbjct: 22 LFDTHCHFDFPPFTATPELELQKAAQHGVRRLVVPSI 58 >gi|313159695|gb|EFR59052.1| hydrolase, TatD family [Alistipes sp. HGB5] Length = 262 Score = 36.5 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 L +TH H P+FD DR + RA A V + Sbjct: 3 LTDTHSHLYAPEFDADREEALARAADAGVER 33 >gi|15678261|ref|NP_275376.1| hypothetical protein MTH233 [Methanothermobacter thermautotrophicus str. Delta H] gi|2621281|gb|AAB84739.1| conserved protein [Methanothermobacter thermautotrophicus str. Delta H] Length = 256 Score = 36.5 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 16/26 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAH 26 ++I+ HCH DF+ +R VI RA Sbjct: 5 IIIDVHCHLDFKDFNRNREEVIERAR 30 >gi|258623870|ref|ZP_05718824.1| Putative deoxyribonuclease yjjV [Vibrio mimicus VM603] gi|258583859|gb|EEW08654.1| Putative deoxyribonuclease yjjV [Vibrio mimicus VM603] Length = 283 Score = 36.5 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCHF F + + RA + V +++ Sbjct: 22 LFDTHCHFDFAPFTAEPELELQRAAEQGVKRLL 54 >gi|167625051|ref|YP_001675345.1| TatD-like deoxyribonuclease [Shewanella halifaxensis HAW-EB4] gi|167355073|gb|ABZ77686.1| TatD-related deoxyribonuclease [Shewanella halifaxensis HAW-EB4] Length = 257 Score = 36.5 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I++H H P FD+DR + H + K++ Sbjct: 4 IIDSHAHIDFPVFDDDRAALFENMHAVGIDKVL 36 >gi|296230148|ref|XP_002760582.1| PREDICTED: putative deoxyribonuclease TATDN3-like isoform 1 [Callithrix jacchus] Length = 281 Score = 36.5 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|296230150|ref|XP_002760583.1| PREDICTED: putative deoxyribonuclease TATDN3-like isoform 2 [Callithrix jacchus] Length = 273 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHLSAPDFDRDLDDVLEKAKK 33 >gi|229039944|ref|ZP_04189709.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH676] gi|228727403|gb|EEL78595.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH676] Length = 255 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 17/36 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ D VI R +A V + I Sbjct: 1 MLFDTHSHLNAEQFEGDLQEVIARMKEAGVTYTVVI 36 >gi|167764759|ref|ZP_02436880.1| hypothetical protein BACSTE_03150 [Bacteroides stercoris ATCC 43183] gi|167697428|gb|EDS14007.1| hypothetical protein BACSTE_03150 [Bacteroides stercoris ATCC 43183] Length = 259 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 L+++H H L DF D V+MRA +A V + Sbjct: 3 LVDSHSHLFLEDFQSDLPQVMMRAREAGVTHI 34 >gi|78224427|ref|YP_386174.1| TatD-related deoxyribonuclease:amidohydrolase 2 [Geobacter metallireducens GS-15] gi|78195682|gb|ABB33449.1| TatD-related deoxyribonuclease:Amidohydrolase 2 [Geobacter metallireducens GS-15] Length = 252 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ML +THCH P V+ A QA V ++I Sbjct: 1 MLTDTHCHLDDPTLSSRLGEVMAAARQAGVGRII 34 >gi|254285987|ref|ZP_04960948.1| conserved hypothetical protein [Vibrio cholerae AM-19226] gi|150423897|gb|EDN15837.1| conserved hypothetical protein [Vibrio cholerae AM-19226] Length = 283 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF P F + +A Q V +++ +I Sbjct: 22 LFDTHCHFDFPPFTATPELELQKAAQHGVRRLVVPSI 58 >gi|323490979|ref|ZP_08096173.1| putative deoxyribonuclease yabD [Planococcus donghaensis MPA1U2] gi|323395335|gb|EGA88187.1| putative deoxyribonuclease yabD [Planococcus donghaensis MPA1U2] Length = 258 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M I+TH H +DED VI RA + +V KM+ I Sbjct: 1 MFIDTHVHLNADQYDEDLVEVIERARENHVEKMVVI 36 >gi|268679300|ref|YP_003303731.1| hydrolase, TatD family [Sulfurospirillum deleyianum DSM 6946] gi|268617331|gb|ACZ11696.1| hydrolase, TatD family [Sulfurospirillum deleyianum DSM 6946] Length = 266 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+THCH + +D VI RA+ A V +I Sbjct: 1 MIIDTHCHLDDERYVDDVDVVIQRAYDAGVRGII 34 >gi|116071173|ref|ZP_01468442.1| TatD-related deoxyribonuclease [Synechococcus sp. BL107] gi|116066578|gb|EAU72335.1| TatD-related deoxyribonuclease [Synechococcus sp. BL107] Length = 262 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + +F++D +V R +A V ++ ++ Sbjct: 7 LIDSHCHIVFRNFEDDLEDVATRWREAGVKALLHACVE 44 >gi|152997506|ref|YP_001342341.1| TatD-like deoxyribonuclease [Marinomonas sp. MWYL1] gi|150838430|gb|ABR72406.1| TatD-related deoxyribonuclease [Marinomonas sp. MWYL1] Length = 259 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 19/38 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I++HCH FDE R ++++ + V + A Sbjct: 1 MFIDSHCHLDFDVFDEQRDSLMLSCLENKVAGFLVPAT 38 >gi|317010264|gb|ADU80844.1| Mg-dependent DNase [Helicobacter pylori India7] Length = 254 Score = 36.5 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHKDYENDLEEVLKESLEKGVTRCV 34 >gi|126654256|ref|ZP_01726044.1| TatD related DNase [Bacillus sp. B14905] gi|126589289|gb|EAZ83447.1| TatD related DNase [Bacillus sp. B14905] Length = 256 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 22/36 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M I+TH H ++ED +VI RA +A V KM+ I Sbjct: 1 MFIDTHVHLNADQYEEDLQDVINRALEAKVEKMVVI 36 >gi|251791150|ref|YP_003005871.1| TatD-related deoxyribonuclease [Dickeya zeae Ech1591] gi|247539771|gb|ACT08392.1| TatD-related deoxyribonuclease [Dickeya zeae Ech1591] Length = 290 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 21/40 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 I+THCHF P F +D + A QA V ++I A+ Sbjct: 30 FIDTHCHFDFPLFADDAAGSLALAAQAGVGRLIVPAVAAE 69 >gi|258620914|ref|ZP_05715948.1| Putative deoxyribonuclease yjjV [Vibrio mimicus VM573] gi|258586302|gb|EEW11017.1| Putative deoxyribonuclease yjjV [Vibrio mimicus VM573] Length = 283 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCHF F + + RA + V +++ Sbjct: 22 LFDTHCHFDFAPFTAEPELELQRAAEQGVKRLL 54 >gi|319779572|ref|YP_004130485.1| Putative deoxyribonuclease YcfH [Taylorella equigenitalis MCE9] gi|317109596|gb|ADU92342.1| Putative deoxyribonuclease YcfH [Taylorella equigenitalis MCE9] Length = 258 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 9/38 (23%), Positives = 21/38 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M +++HCH P+ +D +++ R + +V + I + Sbjct: 1 MFVDSHCHLDFPELIQDLDDILDRMKRNSVEHALCINV 38 >gi|253579411|ref|ZP_04856681.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA] gi|251849509|gb|EES77469.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA] Length = 263 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 22/40 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M+I+TH H+ FD DR ++M + + K++ + V Sbjct: 7 MIIDTHAHYDDEAFDTDREALLMSMYDGGIEKIVNVCASV 46 >gi|121730325|ref|ZP_01682690.1| chitobiase [Vibrio cholerae V52] gi|121627926|gb|EAX60499.1| chitobiase [Vibrio cholerae V52] Length = 248 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF P F + +A Q V +++ +I Sbjct: 13 LFDTHCHFDFPPFTATPELELQKAAQHGVRRLVVPSI 49 >gi|239815831|ref|YP_002944741.1| hydrolase, TatD family [Variovorax paradoxus S110] gi|239802408|gb|ACS19475.1| hydrolase, TatD family [Variovorax paradoxus S110] Length = 269 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 19/41 (46%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M ++HCH P+F + + +A V + + I K+ Sbjct: 1 MFTDSHCHLTFPEFADQMPQIRAAMAEAQVDRALCICTKLE 41 >gi|258542242|ref|YP_003187675.1| deoxyribonuclease TatD [Acetobacter pasteurianus IFO 3283-01] gi|256633320|dbj|BAH99295.1| deoxyribonuclease TatD [Acetobacter pasteurianus IFO 3283-01] gi|256636379|dbj|BAI02348.1| deoxyribonuclease TatD [Acetobacter pasteurianus IFO 3283-03] gi|256639432|dbj|BAI05394.1| deoxyribonuclease TatD [Acetobacter pasteurianus IFO 3283-07] gi|256642488|dbj|BAI08443.1| deoxyribonuclease TatD [Acetobacter pasteurianus IFO 3283-22] gi|256645543|dbj|BAI11491.1| deoxyribonuclease TatD [Acetobacter pasteurianus IFO 3283-26] gi|256648596|dbj|BAI14537.1| deoxyribonuclease TatD [Acetobacter pasteurianus IFO 3283-32] gi|256651649|dbj|BAI17583.1| deoxyribonuclease TatD [Acetobacter pasteurianus IFO 3283-01-42C] gi|256654640|dbj|BAI20567.1| deoxyribonuclease TatD [Acetobacter pasteurianus IFO 3283-12] Length = 270 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 LI++HCH E+ ++ A +A + M+ I ++ R Sbjct: 12 LIDSHCHLDHFS-AEEMPELLEAAKEAGLSGMVTIGTRLAR 51 >gi|167957601|ref|ZP_02544675.1| sec-independent protein translocase protein [candidate division TM7 single-cell isolate TM7c] Length = 251 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MLINTHCHFLLPDFD-EDRHNVIMRAHQANVLKMIAIAIKVIRT 43 MLI+THCH ++D +I RA ++V K+I I + + Sbjct: 1 MLIDTHCHIQDSNYDFPSIDELIKRARNSSVDKIICIGTNLKNS 44 >gi|260556095|ref|ZP_05828314.1| hydrolase [Acinetobacter baumannii ATCC 19606] gi|260410150|gb|EEX03449.1| hydrolase [Acinetobacter baumannii ATCC 19606] Length = 270 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DFDEDR + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFDEDRQQLALEAKKMGVDALVLI 37 >gi|59710659|ref|YP_203435.1| DNase, TatD family [Vibrio fischeri ES114] gi|59478760|gb|AAW84547.1| DNase, TatD Family [Vibrio fischeri ES114] Length = 253 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FDEDR V+ RA + + K++ Sbjct: 1 MIDTHAHIYAKEFDEDRDAVVQRALEQGISKIL 33 >gi|83814681|ref|YP_445423.1| TatD family hydrolase [Salinibacter ruber DSM 13855] gi|294507305|ref|YP_003571363.1| TatD related DNase [Salinibacter ruber M8] gi|83756075|gb|ABC44188.1| hydrolase, TatD family [Salinibacter ruber DSM 13855] gi|294343633|emb|CBH24411.1| TatD related DNase [Salinibacter ruber M8] Length = 262 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 24/40 (60%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M+I+TH H L FDEDR V+ RA A V ++ AI V Sbjct: 1 MIIDTHAHLYLDQFDEDRDAVLRRAWGAEVDVVVMPAIDV 40 >gi|282857415|ref|ZP_06266648.1| Mg-dependent DNase [Pyramidobacter piscolens W5455] gi|282584700|gb|EFB90035.1| Mg-dependent DNase [Pyramidobacter piscolens W5455] Length = 263 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 +++HCH P+ V+ RA A V++M I Sbjct: 4 VDSHCHLNSPELRGGIPAVLERARAAGVVRMAVIGS 39 >gi|323465386|gb|ADX77539.1| hydrolase, TatD family [Staphylococcus pseudintermedius ED99] Length = 255 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +D+D +VI RA A V +M + Sbjct: 1 MLIDTHVHLNADQYDKDLEDVIQRALDAGVDRMFVV 36 >gi|153803803|ref|ZP_01958389.1| putative deoxyribonuclease YjjV [Vibrio cholerae MZO-3] gi|124120663|gb|EAY39406.1| putative deoxyribonuclease YjjV [Vibrio cholerae MZO-3] Length = 242 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF P F + +A Q V +++ +I Sbjct: 13 LFDTHCHFDFPPFTATPELELQKAAQHGVRRLVVPSI 49 >gi|255320518|ref|ZP_05361699.1| hydrolase, TatD family [Acinetobacter radioresistens SK82] gi|262378410|ref|ZP_06071567.1| Mg-dependent DNase [Acinetobacter radioresistens SH164] gi|255302490|gb|EET81726.1| hydrolase, TatD family [Acinetobacter radioresistens SK82] gi|262299695|gb|EEY87607.1| Mg-dependent DNase [Acinetobacter radioresistens SH164] Length = 257 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Query: 1 MLINTHCHF---LLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M ++THCH L +D D I A V KM++I++ + Sbjct: 1 MFVDTHCHLTLLDLSPYDGDIDLAIQAAKDVGVSKMMSISVNL 43 >gi|156935513|ref|YP_001439429.1| hypothetical protein ESA_03372 [Cronobacter sakazakii ATCC BAA-894] gi|156533767|gb|ABU78593.1| hypothetical protein ESA_03372 [Cronobacter sakazakii ATCC BAA-894] Length = 261 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 20/41 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F + +A A V +I A++ R Sbjct: 5 FIDTHCHFDFPPFTGTEAESLAQAASAGVEHIIVPAVEAAR 45 >gi|319891444|ref|YP_004148319.1| Putative deoxyribonuclease YcfH [Staphylococcus pseudintermedius HKU10-03] gi|317161140|gb|ADV04683.1| Putative deoxyribonuclease YcfH [Staphylococcus pseudintermedius HKU10-03] Length = 255 Score = 36.5 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H +D+D +VI RA A V +M + Sbjct: 1 MLIDTHVHLNADQYDKDLEDVIQRALDAGVDRMFVV 36 >gi|197334168|ref|YP_002154822.1| hydrolase, TatD family [Vibrio fischeri MJ11] gi|197315658|gb|ACH65105.1| hydrolase, TatD family [Vibrio fischeri MJ11] Length = 253 Score = 36.5 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FDEDR V+ RA + + K++ Sbjct: 1 MIDTHAHIYAKEFDEDRDAVVQRALEQGISKIL 33 >gi|262274863|ref|ZP_06052674.1| putative deoxyribonuclease YjjV [Grimontia hollisae CIP 101886] gi|262221426|gb|EEY72740.1| putative deoxyribonuclease YjjV [Grimontia hollisae CIP 101886] Length = 261 Score = 36.5 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 +I+THCHF P F +D + R+ + +I A+ Sbjct: 1 MIDTHCHFDFPPFSDDPAYWVQRSKDTGIQHLIVPAV 37 >gi|134296293|ref|YP_001120028.1| TatD-related deoxyribonuclease [Burkholderia vietnamiensis G4] gi|134139450|gb|ABO55193.1| TatD-related deoxyribonuclease [Burkholderia vietnamiensis G4] Length = 262 Score = 36.5 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAGEFDADRDAVAQAACAAGVSRIV 34 >gi|224373223|ref|YP_002607595.1| deoxyribonuclease, TatD family [Nautilia profundicola AmH] gi|223589782|gb|ACM93518.1| deoxyribonuclease, TatD family [Nautilia profundicola AmH] Length = 249 Score = 36.1 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+TH H F +D +VI RA + V K I Sbjct: 1 MIIDTHTHLDNQKFIDDVDDVIKRAKEHGVGKFI 34 >gi|160939615|ref|ZP_02086963.1| hypothetical protein CLOBOL_04507 [Clostridium bolteae ATCC BAA-613] gi|158437406|gb|EDP15170.1| hypothetical protein CLOBOL_04507 [Clostridium bolteae ATCC BAA-613] Length = 261 Score = 36.1 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 M+ +TH H+ FD DR ++ R +A V ++ +A Sbjct: 8 MIFDTHAHYDDEAFDGDRPELLGRLKEAGVGAVMNVA 44 >gi|332160206|ref|YP_004296783.1| putative metalloenzyme [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|318607229|emb|CBY28727.1| putative deoxyribonuclease YjjV [Yersinia enterocolitica subsp. palearctica Y11] gi|325664436|gb|ADZ41080.1| putative metalloenzyme [Yersinia enterocolitica subsp. palearctica 105.5R(r)] Length = 272 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 I+THCHF P F ++ A QANV ++I A+ Sbjct: 11 FIDTHCHFDFPPFRGAEVASLLSAGQANVKQIIVPAV 47 >gi|313906148|ref|ZP_07839497.1| hydrolase, TatD family [Eubacterium cellulosolvens 6] gi|313469035|gb|EFR64388.1| hydrolase, TatD family [Eubacterium cellulosolvens 6] Length = 261 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 M+ +TH H+ FD DR V+ + VL+ + ++ Sbjct: 1 MIFDTHTHYDDEAFDGDREEVLSSIREQGVLRFVNVS 37 >gi|167570512|ref|ZP_02363386.1| hydrolase, TatD family protein [Burkholderia oklahomensis C6786] Length = 262 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAAEFDADREAVADAARAAGVSRIV 34 >gi|119897889|ref|YP_933102.1| putative deoxyribonuclease [Azoarcus sp. BH72] gi|119670302|emb|CAL94215.1| putative deoxyribonuclease [Azoarcus sp. BH72] Length = 256 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 19/41 (46%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH PD V+ +V + +++K+ Sbjct: 1 MYVDSHCHLDFPDLIAREDEVLAAMAANDVRHALCVSVKLE 41 >gi|115352200|ref|YP_774039.1| TatD-related deoxyribonuclease [Burkholderia ambifaria AMMD] gi|115282188|gb|ABI87705.1| TatD-related deoxyribonuclease [Burkholderia ambifaria AMMD] Length = 262 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAGEFDADRDAVAEAARAAGVSRIV 34 >gi|167563340|ref|ZP_02356256.1| hydrolase, TatD family protein [Burkholderia oklahomensis EO147] Length = 262 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V +++ Sbjct: 1 MWIDTHCHLDAAEFDADREAVADAARAAGVSRIV 34 >gi|34499175|ref|NP_903390.1| hypothetical protein CV_3720 [Chromobacterium violaceum ATCC 12472] gi|34105026|gb|AAQ61382.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 256 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 MLI++HCH PD E +V+ Q V + I + Sbjct: 1 MLIDSHCHINFPDLAERMPDVLANMRQNQVTHALVIGV 38 >gi|300119134|ref|ZP_07056835.1| deoxyribonuclease, TatD family protein [Bacillus cereus SJ1] gi|298723456|gb|EFI64197.1| deoxyribonuclease, TatD family protein [Bacillus cereus SJ1] Length = 255 Score = 36.1 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|330994632|ref|ZP_08318555.1| Putative deoxyribonuclease [Gluconacetobacter sp. SXCC-1] gi|329758273|gb|EGG74794.1| Putative deoxyribonuclease [Gluconacetobacter sp. SXCC-1] Length = 265 Score = 36.1 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 L ++HCH + ++ R QA V M+ I ++ Sbjct: 6 LTDSHCHLDHFS-AGEMPEILARTRQAGVDGMVTIGTRL 43 >gi|329850685|ref|ZP_08265530.1| urease/pyrimidinase family protein [Asticcacaulis biprosthecum C19] gi|328841000|gb|EGF90571.1| urease/pyrimidinase family protein [Asticcacaulis biprosthecum C19] Length = 90 Score = 36.1 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 17/29 (58%) Query: 12 PDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 P FD+DR VI RA A V MI I +V Sbjct: 4 PQFDDDRDQVIDRARAAGVGLMINICDRV 32 >gi|319792027|ref|YP_004153667.1| tatD-related deoxyribonuclease [Variovorax paradoxus EPS] gi|315594490|gb|ADU35556.1| TatD-related deoxyribonuclease [Variovorax paradoxus EPS] Length = 286 Score = 36.1 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 18/39 (46%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ++THCH P+F + + RA V + A+ V Sbjct: 4 FVDTHCHLDAPEFGAEMPQIRARAAAQGVSLCVIPAVAV 42 >gi|169825669|ref|YP_001695827.1| putative deoxyribonuclease yabD [Lysinibacillus sphaericus C3-41] gi|168990157|gb|ACA37697.1| Putative deoxyribonuclease yabD [Lysinibacillus sphaericus C3-41] Length = 256 Score = 36.1 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M I+TH H ++ED VI RA +A V KM+ I Sbjct: 1 MFIDTHVHLNADQYEEDLQEVINRALEAKVEKMVVI 36 >gi|262375368|ref|ZP_06068601.1| Mg-dependent DNase [Acinetobacter lwoffii SH145] gi|262309622|gb|EEY90752.1| Mg-dependent DNase [Acinetobacter lwoffii SH145] Length = 257 Score = 36.1 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Query: 1 MLINTHCHFLLPD---FDEDRHNVIMRAHQANVLKMIAIAI 38 M ++THCH L D + D + +A +A V K ++I++ Sbjct: 1 MFVDTHCHLTLLDLTPYHGDLDQALAQAREAGVSKFMSISV 41 >gi|229917421|ref|YP_002886067.1| hydrolase, TatD family [Exiguobacterium sp. AT1b] gi|229468850|gb|ACQ70622.1| hydrolase, TatD family [Exiguobacterium sp. AT1b] Length = 255 Score = 36.1 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H F ED I RA +A V ++ + Sbjct: 1 MLIDTHTHINAEQFSEDVEETIERAREAGVSPLLVV 36 >gi|221068824|ref|ZP_03544929.1| TatD-related deoxyribonuclease [Comamonas testosteroni KF-1] gi|220713847|gb|EED69215.1| TatD-related deoxyribonuclease [Comamonas testosteroni KF-1] Length = 278 Score = 36.1 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCH P+F DR V A A V ++ A++ Sbjct: 10 IDTHCHLDAPEFAPDRDAVRAAAQAAGVKHLVIPAVQ 46 >gi|229077317|ref|ZP_04209995.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock4-2] gi|228705989|gb|EEL58299.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock4-2] Length = 254 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|229100828|ref|ZP_04231643.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock3-28] gi|228682595|gb|EEL36657.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock3-28] Length = 255 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|224824705|ref|ZP_03697812.1| hydrolase, TatD family [Lutiella nitroferrum 2002] gi|224603198|gb|EEG09374.1| hydrolase, TatD family [Lutiella nitroferrum 2002] Length = 257 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 16/38 (42%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ML+++HCH PD V+ V + I + Sbjct: 1 MLVDSHCHINFPDLAARLPEVLANMRHNGVSHALVIGV 38 >gi|37678368|ref|NP_932977.1| Mg-dependent DNase [Vibrio vulnificus YJ016] gi|37197107|dbj|BAC92948.1| Mg-dependent DNase [Vibrio vulnificus YJ016] Length = 256 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD+DR V+ RA + + K++ Sbjct: 1 MIDTHAHIYAKEFDQDRDQVVQRALEQGIEKIL 33 >gi|262370381|ref|ZP_06063707.1| Mg-dependent DNase [Acinetobacter johnsonii SH046] gi|262314723|gb|EEY95764.1| Mg-dependent DNase [Acinetobacter johnsonii SH046] Length = 257 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Query: 1 MLINTHCHF---LLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M ++THCH L +D D + +A +A V + ++I++ + Sbjct: 1 MFVDTHCHLTMLDLTPYDGDLDLALAQAREAGVHRFMSISVDI 43 >gi|229074101|ref|ZP_04207148.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock4-18] gi|229094761|ref|ZP_04225767.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock3-29] gi|229113714|ref|ZP_04243150.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock1-3] gi|228669711|gb|EEL25117.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock1-3] gi|228688629|gb|EEL42501.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock3-29] gi|228708995|gb|EEL61121.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock4-18] Length = 255 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|47569888|ref|ZP_00240555.1| sec-independent secretion protein tatD [Bacillus cereus G9241] gi|206977946|ref|ZP_03238833.1| deoxyribonuclease, TatD family [Bacillus cereus H3081.97] gi|217957615|ref|YP_002336157.1| deoxyribonuclease, TatD family [Bacillus cereus AH187] gi|222093809|ref|YP_002527858.1| tatd related dnase [Bacillus cereus Q1] gi|228983295|ref|ZP_04143509.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] gi|229136886|ref|ZP_04265514.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus BDRD-ST26] gi|229153818|ref|ZP_04281949.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus ATCC 4342] gi|47553422|gb|EAL11806.1| sec-independent secretion protein tatD [Bacillus cereus G9241] gi|206743852|gb|EDZ55272.1| deoxyribonuclease, TatD family [Bacillus cereus H3081.97] gi|217066631|gb|ACJ80881.1| deoxyribonuclease, TatD family [Bacillus cereus AH187] gi|221237856|gb|ACM10566.1| TatD related DNase [Bacillus cereus Q1] gi|228629622|gb|EEK86318.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus ATCC 4342] gi|228646551|gb|EEL02757.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus BDRD-ST26] gi|228776409|gb|EEM24761.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] Length = 255 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|30260229|ref|NP_842606.1| TatD family deoxyribonuclease [Bacillus anthracis str. Ames] gi|47525292|ref|YP_016641.1| TatD family deoxyribonuclease [Bacillus anthracis str. 'Ames Ancestor'] gi|49183073|ref|YP_026325.1| TatD family deoxyribonuclease [Bacillus anthracis str. Sterne] gi|49477127|ref|YP_034393.1| TatD related DNase [Bacillus thuringiensis serovar konkukian str. 97-27] gi|65317499|ref|ZP_00390458.1| COG0084: Mg-dependent DNase [Bacillus anthracis str. A2012] gi|165872589|ref|ZP_02217221.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0488] gi|167635090|ref|ZP_02393407.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0442] gi|167641534|ref|ZP_02399782.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0193] gi|170688917|ref|ZP_02880119.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0465] gi|170707566|ref|ZP_02898019.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0389] gi|177655347|ref|ZP_02936876.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0174] gi|190568989|ref|ZP_03021890.1| deoxyribonuclease, TatD family [Bacillus anthracis Tsiankovskii-I] gi|196036356|ref|ZP_03103753.1| deoxyribonuclease, TatD family [Bacillus cereus W] gi|196041786|ref|ZP_03109076.1| deoxyribonuclease, TatD family [Bacillus cereus NVH0597-99] gi|218901240|ref|YP_002449074.1| deoxyribonuclease, TatD family [Bacillus cereus AH820] gi|227812712|ref|YP_002812721.1| deoxyribonuclease, TatD family [Bacillus anthracis str. CDC 684] gi|228912779|ref|ZP_04076427.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] gi|228931542|ref|ZP_04094449.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] gi|228943846|ref|ZP_04106232.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|229089171|ref|ZP_04220453.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock3-42] gi|229119702|ref|ZP_04248964.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus 95/8201] gi|229604431|ref|YP_002864690.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0248] gi|254682334|ref|ZP_05146195.1| deoxyribonuclease, TatD family protein [Bacillus anthracis str. CNEVA-9066] gi|254733575|ref|ZP_05191296.1| deoxyribonuclease, TatD family protein [Bacillus anthracis str. Western North America USA6153] gi|254744657|ref|ZP_05202336.1| deoxyribonuclease, TatD family protein [Bacillus anthracis str. Kruger B] gi|254756362|ref|ZP_05208391.1| deoxyribonuclease, TatD family protein [Bacillus anthracis str. Vollum] gi|254762418|ref|ZP_05214260.1| deoxyribonuclease, TatD family protein [Bacillus anthracis str. Australia 94] gi|301051775|ref|YP_003789986.1| TatD related DNase [Bacillus anthracis CI] gi|30253550|gb|AAP24092.1| deoxyribonuclease, TatD family [Bacillus anthracis str. Ames] gi|47500440|gb|AAT29116.1| deoxyribonuclease, TatD family [Bacillus anthracis str. 'Ames Ancestor'] gi|49177000|gb|AAT52376.1| deoxyribonuclease, TatD family [Bacillus anthracis str. Sterne] gi|49328683|gb|AAT59329.1| TatD related DNase [Bacillus thuringiensis serovar konkukian str. 97-27] gi|164711717|gb|EDR17262.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0488] gi|167510519|gb|EDR85917.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0193] gi|167529564|gb|EDR92314.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0442] gi|170127562|gb|EDS96436.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0389] gi|170667141|gb|EDT17902.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0465] gi|172080188|gb|EDT65281.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0174] gi|190559913|gb|EDV13897.1| deoxyribonuclease, TatD family [Bacillus anthracis Tsiankovskii-I] gi|195990986|gb|EDX54957.1| deoxyribonuclease, TatD family [Bacillus cereus W] gi|196027406|gb|EDX66023.1| deoxyribonuclease, TatD family [Bacillus cereus NVH0597-99] gi|218535153|gb|ACK87551.1| deoxyribonuclease, TatD family [Bacillus cereus AH820] gi|227002938|gb|ACP12681.1| deoxyribonuclease, TatD family [Bacillus anthracis str. CDC 684] gi|228663727|gb|EEL19305.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus 95/8201] gi|228694134|gb|EEL47815.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock3-42] gi|228815803|gb|EEM62038.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228828094|gb|EEM73821.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] gi|228846839|gb|EEM91843.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] gi|229268839|gb|ACQ50476.1| deoxyribonuclease, TatD family [Bacillus anthracis str. A0248] gi|300373944|gb|ADK02848.1| TatD related DNase [Bacillus cereus biovar anthracis str. CI] Length = 255 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|315224531|ref|ZP_07866358.1| TatD family deoxyribonuclease [Capnocytophaga ochracea F0287] gi|314945552|gb|EFS97574.1| TatD family deoxyribonuclease [Capnocytophaga ochracea F0287] Length = 253 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 +I+TH H +FD DR +I RA A V + Sbjct: 1 MIDTHTHLYSEEFDADRAEMIARAKAAGVTR 31 >gi|189347288|ref|YP_001943817.1| hydrolase, TatD family [Chlorobium limicola DSM 245] gi|189341435|gb|ACD90838.1| hydrolase, TatD family [Chlorobium limicola DSM 245] Length = 257 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M ++ HCH P+FDEDR VI + ++ ++ Sbjct: 1 MYVDVHCHLSFPEFDEDREAVIRQMISDDISLLV 34 >gi|229194430|ref|ZP_04321234.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus m1293] gi|228589020|gb|EEK47034.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus m1293] Length = 255 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|194246553|ref|YP_002004192.1| Mg-dependent DNase [Candidatus Phytoplasma mali] gi|193806910|emb|CAP18339.1| Mg-dependent DNase [Candidatus Phytoplasma mali] Length = 250 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 22/36 (61%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H D+D D VI+RA +V K+I + Sbjct: 1 MLIDTHAHLNQSDYDNDLETVILRAFNNDVKKIIVV 36 >gi|118475811|ref|YP_892962.1| TatD family deoxyribonuclease [Bacillus thuringiensis str. Al Hakam] gi|196047396|ref|ZP_03114609.1| deoxyribonuclease, TatD family [Bacillus cereus 03BB108] gi|225862091|ref|YP_002747469.1| deoxyribonuclease, TatD family [Bacillus cereus 03BB102] gi|229182434|ref|ZP_04309686.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus BGSC 6E1] gi|118415036|gb|ABK83455.1| deoxyribonuclease, TatD family [Bacillus thuringiensis str. Al Hakam] gi|196021798|gb|EDX60492.1| deoxyribonuclease, TatD family [Bacillus cereus 03BB108] gi|225790962|gb|ACO31179.1| deoxyribonuclease, TatD family [Bacillus cereus 03BB102] gi|228601014|gb|EEK58582.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus BGSC 6E1] Length = 255 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|157827626|ref|YP_001496690.1| putative deoxyribonuclease TatD [Rickettsia bellii OSU 85-389] gi|157802930|gb|ABV79653.1| Putative deoxyribonuclease TatD [Rickettsia bellii OSU 85-389] Length = 287 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++HCH L D + ++I +A + NV + I K+ Sbjct: 1 MLIDSHCHLNLLK-DVEIDDIIKQAIENNVQYLQTICTKL 39 >gi|325845613|ref|ZP_08168898.1| hydrolase, TatD family [Turicibacter sp. HGF1] gi|325488356|gb|EGC90780.1| hydrolase, TatD family [Turicibacter sp. HGF1] Length = 255 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI RA V KM+ + Sbjct: 1 MLFDTHVHLNDKKFEEDLMEVIERAKDEGVSKMLVV 36 >gi|293376971|ref|ZP_06623185.1| hydrolase, TatD family [Turicibacter sanguinis PC909] gi|292644411|gb|EFF62507.1| hydrolase, TatD family [Turicibacter sanguinis PC909] Length = 255 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI RA V KM+ + Sbjct: 1 MLFDTHVHLNDKKFEEDLMEVIERAKDEGVSKMLVV 36 >gi|262407031|ref|ZP_06083580.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|294646603|ref|ZP_06724235.1| hydrolase, TatD family [Bacteroides ovatus SD CC 2a] gi|294809765|ref|ZP_06768449.1| hydrolase, TatD family [Bacteroides xylanisolvens SD CC 1b] gi|298479709|ref|ZP_06997909.1| hydrolase, TatD family [Bacteroides sp. D22] gi|262355734|gb|EEZ04825.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|292638045|gb|EFF56431.1| hydrolase, TatD family [Bacteroides ovatus SD CC 2a] gi|294443005|gb|EFG11788.1| hydrolase, TatD family [Bacteroides xylanisolvens SD CC 1b] gi|298274099|gb|EFI15660.1| hydrolase, TatD family [Bacteroides sp. D22] Length = 258 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANV 30 MLI+TH H + +F ED V+ RA +A V Sbjct: 1 MLIDTHSHLFVEEFTEDLPQVMERARKAGV 30 >gi|212634082|ref|YP_002310607.1| TatD family hydrolase [Shewanella piezotolerans WP3] gi|212555566|gb|ACJ28020.1| Hydrolase, TatD family [Shewanella piezotolerans WP3] Length = 268 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 8/33 (24%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I++H H +FD DR + + V +++ Sbjct: 15 MIDSHAHLDFSEFDHDRGELFQQMRDLGVEQVV 47 >gi|332177801|gb|AEE13491.1| hydrolase, TatD family [Porphyromonas asaccharolytica DSM 20707] Length = 263 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI+TH H ++D DR VI A QA V M+ Sbjct: 1 MLIDTHTHIYGVEYDSDREAVISAAGQAGVGYMV 34 >gi|256819110|ref|YP_003140389.1| hydrolase, TatD family [Capnocytophaga ochracea DSM 7271] gi|256580693|gb|ACU91828.1| hydrolase, TatD family [Capnocytophaga ochracea DSM 7271] Length = 253 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 +I+TH H +FD DR +I RA A V + Sbjct: 1 MIDTHTHLYSEEFDADRTEMIARAKAAGVTR 31 >gi|228925293|ref|ZP_04088390.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] gi|228834340|gb|EEM79880.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] Length = 255 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|254455479|ref|ZP_05068908.1| deoxyribonuclease, TatD family [Candidatus Pelagibacter sp. HTCC7211] gi|207082481|gb|EDZ59907.1| deoxyribonuclease, TatD family [Candidatus Pelagibacter sp. HTCC7211] Length = 253 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 19/40 (47%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +I++HCH D N+I R+ + K++ I+ Sbjct: 1 MIDSHCHLDHEPLINDLPNIIRRSKNVGIEKLLTISTSFE 40 >gi|324324029|gb|ADY19289.1| TatD related DNase [Bacillus thuringiensis serovar finitimus YBT-020] Length = 255 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|113954979|ref|YP_731557.1| hydrolase, TatD family protein [Synechococcus sp. CC9311] gi|113882330|gb|ABI47288.1| hydrolase, TatD family protein [Synechococcus sp. CC9311] Length = 261 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + F++D V +R +A V ++ ++ Sbjct: 6 LIDSHCHIVFRTFEDDLDAVALRWREAGVTALLHACVE 43 >gi|71066237|ref|YP_264964.1| TatD family Mg-dependent DNase [Psychrobacter arcticus 273-4] gi|71039222|gb|AAZ19530.1| probable Mg-dependent deoxyribonuclease, TatD family [Psychrobacter arcticus 273-4] Length = 335 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 19/35 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+TH HF P FDEDR A+ V ++ + Sbjct: 19 LIDTHTHFDAPVFDEDRDEQAQFAYDKGVRHLVLV 53 >gi|51894386|ref|YP_077077.1| TatD-related DNase [Symbiobacterium thermophilum IAM 14863] gi|51858075|dbj|BAD42233.1| TatD-related DNase [Symbiobacterium thermophilum IAM 14863] Length = 258 Score = 36.1 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 1 MLINTHCHFLLP-DFDEDRHNVIMRAHQANVLKMIAI 36 ML NTH H F DR V+ RA + V +++ I Sbjct: 1 MLFNTHSHVDTGRQFAVDRDEVVARAREMGVSQLMVI 37 >gi|313886917|ref|ZP_07820620.1| hydrolase, TatD family [Porphyromonas asaccharolytica PR426713P-I] gi|312923614|gb|EFR34420.1| hydrolase, TatD family [Porphyromonas asaccharolytica PR426713P-I] Length = 263 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI+TH H ++D DR VI A QA V M+ Sbjct: 1 MLIDTHTHIYGVEYDSDREAVISAAGQAGVGYMV 34 >gi|229170890|ref|ZP_04298493.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus MM3] gi|228612556|gb|EEK69775.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus MM3] Length = 255 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|254494987|ref|ZP_01053153.2| TatD related DNase [Polaribacter sp. MED152] gi|213690569|gb|EAQ42581.2| TatD related DNase [Polaribacter sp. MED152] Length = 268 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 18/32 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 M+ +TH H FDEDR +I RA A V + Sbjct: 15 MITDTHTHLYSEQFDEDRKAMIQRAKDAGVSR 46 >gi|331002317|ref|ZP_08325835.1| hypothetical protein HMPREF0491_00697 [Lachnospiraceae oral taxon 107 str. F0167] gi|330410133|gb|EGG89567.1| hypothetical protein HMPREF0491_00697 [Lachnospiraceae oral taxon 107 str. F0167] Length = 261 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 11/42 (26%), Positives = 22/42 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 +I+TH H+ FDEDR ++ A + +++ I + + Sbjct: 9 IIDTHAHYDDEAFDEDRDELLRSFEDAGIKRVVNIGASMKSS 50 >gi|319943558|ref|ZP_08017840.1| TatD family deoxyribonuclease [Lautropia mirabilis ATCC 51599] gi|319743373|gb|EFV95778.1| TatD family deoxyribonuclease [Lautropia mirabilis ATCC 51599] Length = 267 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 21/41 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH LP+F E +V+ V + ++I + Sbjct: 1 MFVDSHCHLDLPEFQERLPDVLATMAAEGVEHALCVSITLE 41 >gi|220905931|ref|YP_002481242.1| TatD family hydrolase [Cyanothece sp. PCC 7425] gi|219862542|gb|ACL42881.1| hydrolase, TatD family [Cyanothece sp. PCC 7425] Length = 281 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 9/38 (23%), Positives = 18/38 (47%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 L+++H H F D + R QA V+ ++ ++ Sbjct: 3 LVDSHVHLNFDQFQPDLDAIAERWRQAGVVGLVHSCVE 40 >gi|153005308|ref|YP_001379633.1| TatD family hydrolase [Anaeromyxobacter sp. Fw109-5] gi|152028881|gb|ABS26649.1| hydrolase, TatD family [Anaeromyxobacter sp. Fw109-5] Length = 259 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI++H H D+ D V+ RA A + +++ + Sbjct: 3 LIDSHAHLDCADYVHDLDGVVSRARAAGLERIVCV 37 >gi|323499678|ref|ZP_08104646.1| deoxyribonuclease TatD [Vibrio sinaloensis DSM 21326] gi|323315279|gb|EGA68322.1| deoxyribonuclease TatD [Vibrio sinaloensis DSM 21326] Length = 253 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA Q V +++ Sbjct: 1 MIDTHAHIYASEFDNDRDEVVQRALQQGVERIL 33 >gi|313204027|ref|YP_004042684.1| hydrolase, tatd family [Paludibacter propionicigenes WB4] gi|312443343|gb|ADQ79699.1| hydrolase, TatD family [Paludibacter propionicigenes WB4] Length = 257 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H DFD DR + RA + + +I Sbjct: 1 MIDTHSHIYSEDFDADRAETVQRAKEVGISHII 33 >gi|320157743|ref|YP_004190122.1| putative deoxyribonuclease like YcfH, type 2 [Vibrio vulnificus MO6-24/O] gi|319933055|gb|ADV87919.1| putative deoxyribonuclease YcfH-like protein, type 2 [Vibrio vulnificus MO6-24/O] Length = 256 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD+DR V+ RA + + K++ Sbjct: 1 MIDTHAHIYAKEFDQDRDQVVQRALEQGIEKIL 33 >gi|229027886|ref|ZP_04184041.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH1271] gi|228733400|gb|EEL84227.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH1271] Length = 256 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 2 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 37 >gi|218887320|ref|YP_002436641.1| hydrolase, TatD family [Desulfovibrio vulgaris str. 'Miyazaki F'] gi|218758274|gb|ACL09173.1| hydrolase, TatD family [Desulfovibrio vulgaris str. 'Miyazaki F'] Length = 273 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 15/29 (51%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVL 31 + +H H +FD DR V+ RA A V Sbjct: 21 VESHAHLDGNEFDADREAVLDRARAAGVA 49 >gi|228905836|ref|ZP_04069734.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis IBL 200] gi|228853776|gb|EEM98535.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis IBL 200] Length = 255 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|228937342|ref|ZP_04099989.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar berliner ATCC 10792] gi|228970228|ref|ZP_04130888.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar thuringiensis str. T01001] gi|228976798|ref|ZP_04137211.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis Bt407] gi|228782894|gb|EEM31059.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis Bt407] gi|228789463|gb|EEM37382.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar thuringiensis str. T01001] gi|228822300|gb|EEM68281.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar berliner ATCC 10792] gi|326937831|gb|AEA13727.1| Sec-independent secretion protein tatD [Bacillus thuringiensis serovar chinensis CT-43] Length = 255 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|229015442|ref|ZP_04172444.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH1273] gi|229021647|ref|ZP_04178234.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH1272] gi|228739650|gb|EEL90059.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH1272] gi|228745861|gb|EEL95861.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH1273] Length = 255 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|206972580|ref|ZP_03233523.1| deoxyribonuclease, TatD family [Bacillus cereus AH1134] gi|228950588|ref|ZP_04112723.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar kurstaki str. T03a001] gi|229067804|ref|ZP_04201122.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus F65185] gi|229176640|ref|ZP_04304045.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus 172560W] gi|206732482|gb|EDZ49661.1| deoxyribonuclease, TatD family [Bacillus cereus AH1134] gi|228606807|gb|EEK64223.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus 172560W] gi|228715288|gb|EEL67146.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus F65185] gi|228809063|gb|EEM55547.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar kurstaki str. T03a001] Length = 255 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|88606752|ref|YP_505123.1| TatD family hydrolase [Anaplasma phagocytophilum HZ] gi|88597815|gb|ABD43285.1| hydrolase, TatD family [Anaplasma phagocytophilum HZ] Length = 270 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M++++HCH D R +I A V M + + Sbjct: 1 MIVDSHCHLNYFDSASLRD-IIDHACAVGVSLMQTVCTTIE 40 >gi|163938047|ref|YP_001642931.1| TatD family hydrolase [Bacillus weihenstephanensis KBAB4] gi|229009549|ref|ZP_04166776.1| Uncharacterized deoxyribonuclease yabD [Bacillus mycoides DSM 2048] gi|229131047|ref|ZP_04259960.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus BDRD-ST196] gi|229165028|ref|ZP_04292824.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH621] gi|163860244|gb|ABY41303.1| hydrolase, TatD family [Bacillus weihenstephanensis KBAB4] gi|228618413|gb|EEK75442.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH621] gi|228652384|gb|EEL08308.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus BDRD-ST196] gi|228751693|gb|EEM01492.1| Uncharacterized deoxyribonuclease yabD [Bacillus mycoides DSM 2048] Length = 255 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|75759601|ref|ZP_00739687.1| DNase, TatD family [Bacillus thuringiensis serovar israelensis ATCC 35646] gi|218895175|ref|YP_002443586.1| deoxyribonuclease, TatD family [Bacillus cereus G9842] gi|228898793|ref|ZP_04063076.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis IBL 4222] gi|228963138|ref|ZP_04124308.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar sotto str. T04001] gi|74492892|gb|EAO56022.1| DNase, TatD family [Bacillus thuringiensis serovar israelensis ATCC 35646] gi|218542555|gb|ACK94949.1| deoxyribonuclease, TatD family [Bacillus cereus G9842] gi|228796523|gb|EEM43961.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar sotto str. T04001] gi|228860818|gb|EEN05195.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis IBL 4222] Length = 255 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|332037909|gb|EGI74358.1| putative deoxyribonuclease YjjV [Pseudoalteromonas haloplanktis ANT/505] Length = 255 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 8/33 (24%), Positives = 16/33 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I++HCH +F+ R ++I V + + Sbjct: 3 FIDSHCHLDFSEFNSSRESLINECVAKGVNQFV 35 >gi|198276973|ref|ZP_03209504.1| hypothetical protein BACPLE_03180 [Bacteroides plebeius DSM 17135] gi|198270498|gb|EDY94768.1| hypothetical protein BACPLE_03180 [Bacteroides plebeius DSM 17135] Length = 263 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 20/32 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 LI+TH H +FD DR ++RA +A V ++ Sbjct: 4 LIDTHTHLYTEEFDADRELAVIRAVEAGVTRL 35 >gi|42779118|ref|NP_976365.1| TatD family deoxyribonuclease [Bacillus cereus ATCC 10987] gi|42735033|gb|AAS38973.1| deoxyribonuclease, TatD family [Bacillus cereus ATCC 10987] Length = 255 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|52145176|ref|YP_081652.1| TatD related DNase [Bacillus cereus E33L] gi|51978645|gb|AAU20195.1| TatD related DNase [Bacillus cereus E33L] Length = 255 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|317502324|ref|ZP_07960493.1| TatD family Hydrolase [Lachnospiraceae bacterium 8_1_57FAA] gi|331089928|ref|ZP_08338820.1| hypothetical protein HMPREF1025_02403 [Lachnospiraceae bacterium 3_1_46FAA] gi|316896280|gb|EFV18382.1| TatD family Hydrolase [Lachnospiraceae bacterium 8_1_57FAA] gi|330403160|gb|EGG82721.1| hypothetical protein HMPREF1025_02403 [Lachnospiraceae bacterium 3_1_46FAA] Length = 253 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+TH H+ FDEDR ++ + A + ++ Sbjct: 1 MIIDTHAHYDDEQFDEDREEILGKMQDAGIGMIM 34 >gi|261250092|ref|ZP_05942669.1| deoxyribonuclease TatD [Vibrio orientalis CIP 102891] gi|260939596|gb|EEX95581.1| deoxyribonuclease TatD [Vibrio orientalis CIP 102891] Length = 253 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR +V+ RA + K++ Sbjct: 1 MIDTHAHIYASEFDADRDDVVQRALAQGIDKIL 33 >gi|237753418|ref|ZP_04583898.1| hydrolase [Helicobacter winghamensis ATCC BAA-430] gi|229375685|gb|EEO25776.1| hydrolase [Helicobacter winghamensis ATCC BAA-430] Length = 264 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCH FD D ++ RA A + I Sbjct: 3 LCDTHCHLDDERFDTDFDVMLERAQNAGISHFI 35 >gi|183600932|ref|ZP_02962425.1| hypothetical protein PROSTU_04543 [Providencia stuartii ATCC 25827] gi|188019260|gb|EDU57300.1| hypothetical protein PROSTU_04543 [Providencia stuartii ATCC 25827] Length = 260 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F D + + A A V +I Sbjct: 5 FIDTHCHFDFPPFIGDINKSLEAAQAAGVTDII 37 >gi|295112224|emb|CBL28974.1| hydrolase, TatD family [Synergistetes bacterium SGP1] Length = 260 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI++HCH + +D ++ RA A V +M+ + Sbjct: 1 MLIDSHCHPNSDELRKDAEALVERAASAGVGRMLIV 36 >gi|291277365|ref|YP_003517137.1| putative deoxyribonuclease, TatD-related [Helicobacter mustelae 12198] gi|290964559|emb|CBG40412.1| putative deoxyribonuclease, TatD-related [Helicobacter mustelae 12198] Length = 254 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M ++THCH F D VI RA V + + Sbjct: 1 MFVDTHCHLNDVCFVPDVDEVIARARSKGVERFL 34 >gi|229495481|ref|ZP_04389214.1| hydrolase, TatD family [Porphyromonas endodontalis ATCC 35406] gi|229317464|gb|EEN83364.1| hydrolase, TatD family [Porphyromonas endodontalis ATCC 35406] Length = 261 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 23/40 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 +I++H H P+FDEDR V+ RA A V +I I V Sbjct: 1 MIDSHTHIFEPEFDEDRREVLERACGAGVEHLILPNIDVE 40 >gi|27364350|ref|NP_759878.1| putative deoxyribonuclease [Vibrio vulnificus CMCP6] gi|27360469|gb|AAO09405.1| Putative deoxyribonuclease [Vibrio vulnificus CMCP6] Length = 256 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD+DR V+ RA + + K++ Sbjct: 1 MIDTHAHIYAKEFDQDRDQVVQRALEQGIEKIL 33 >gi|315179584|gb|ADT86498.1| Mg-dependent DNase/hypothetical deoxyribonuclease [Vibrio furnissii NCTC 11218] Length = 255 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Query: 1 MLINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAI 38 M +++HCH D+ E +VI +A QANV +++++ + Sbjct: 1 MFVDSHCHLDKLDYQELHTGIEDVIEKARQANVKQLLSVGV 41 >gi|228918990|ref|ZP_04082370.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] gi|229107726|ref|ZP_04237363.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock1-15] gi|229125557|ref|ZP_04254590.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus BDRD-Cer4] gi|229142845|ref|ZP_04271288.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus BDRD-ST24] gi|229148449|ref|ZP_04276706.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus m1550] gi|296500871|ref|YP_003662571.1| Sec-independent secretion protein TatD [Bacillus thuringiensis BMB171] gi|228634991|gb|EEK91563.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus m1550] gi|228640608|gb|EEK96995.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus BDRD-ST24] gi|228657874|gb|EEL13679.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus BDRD-Cer4] gi|228675699|gb|EEL30906.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus Rock1-15] gi|228840639|gb|EEM85900.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] gi|296321923|gb|ADH04851.1| Sec-independent secretion protein tatD [Bacillus thuringiensis BMB171] Length = 255 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 17/36 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ D VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEGDLQEVIARMKEAGVTYTVVV 36 >gi|90406896|ref|ZP_01215087.1| putative deoxyribonuclease [Psychromonas sp. CNPT3] gi|90311938|gb|EAS40032.1| putative deoxyribonuclease [Psychromonas sp. CNPT3] Length = 258 Score = 35.7 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Query: 1 MLINTHCHFLLPDFDE---DRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH D+D D +VI +A V +++ + + Sbjct: 1 MLVDSHCHLDRLDYDARHKDLTDVINKAQAQGVNYFLSVCVTLE 44 >gi|309791102|ref|ZP_07685636.1| TatD family hydrolase [Oscillochloris trichoides DG6] gi|308226856|gb|EFO80550.1| TatD family hydrolase [Oscillochloris trichoides DG6] Length = 262 Score = 35.7 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+TH H FD DR V+ RA +A V +MI + Sbjct: 10 LIDTHTHTTAHQFDHDRAAVLQRASEAGVARMIEV 44 >gi|262369901|ref|ZP_06063228.1| Mg-dependent DNase [Acinetobacter johnsonii SH046] gi|262314940|gb|EEY95980.1| Mg-dependent DNase [Acinetobacter johnsonii SH046] Length = 269 Score = 35.7 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 + +TH HF + DFD DR ++ +A + V ++ I Sbjct: 1 MFDTHTHFDVADFDTDRQHLAEQAKRVGVEALVLI 35 >gi|237809341|ref|YP_002893781.1| TatD-related deoxyribonuclease [Tolumonas auensis DSM 9187] gi|237501602|gb|ACQ94195.1| TatD-related deoxyribonuclease [Tolumonas auensis DSM 9187] Length = 256 Score = 35.7 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 21/38 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ML +TH H L ++ +D V+ R+ A V + + AI Sbjct: 1 MLTDTHIHLDLQEYADDLPQVMARSEAAGVDRWVVPAI 38 >gi|150020802|ref|YP_001306156.1| TatD family hydrolase [Thermosipho melanesiensis BI429] gi|149793323|gb|ABR30771.1| hydrolase, TatD family [Thermosipho melanesiensis BI429] Length = 251 Score = 35.7 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 11/44 (25%), Positives = 25/44 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTL 44 M+++TH H + F++DR VI + +L ++ +A + ++ Sbjct: 1 MIVDTHAHLHMKHFNKDREEVIKKFKDDGILFVVNVATNLKDSV 44 >gi|218231319|ref|YP_002364889.1| deoxyribonuclease, TatD family [Bacillus cereus B4264] gi|218159276|gb|ACK59268.1| deoxyribonuclease, TatD family [Bacillus cereus B4264] Length = 255 Score = 35.7 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 17/36 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ D VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEGDLQEVIARMKEAGVTYTVVV 36 >gi|197286265|ref|YP_002152137.1| TatD-related deoxyribonuclease [Proteus mirabilis HI4320] gi|194683752|emb|CAR44782.1| putative TatD-related deoxyribonuclease [Proteus mirabilis HI4320] Length = 260 Score = 35.7 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F D N + A QA V K+I Sbjct: 4 FIDTHCHFDFPVFYHDLENSLALAQQAQVKKII 36 >gi|260767881|ref|ZP_05876815.1| putative deoxyribonuclease YcfH [Vibrio furnissii CIP 102972] gi|260615911|gb|EEX41096.1| putative deoxyribonuclease YcfH [Vibrio furnissii CIP 102972] Length = 255 Score = 35.7 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Query: 1 MLINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAI 38 M +++HCH D+ E +VI +A QANV +++++ + Sbjct: 1 MFVDSHCHLDKLDYQELHTGIEDVIEKARQANVKQLLSVGV 41 >gi|229521188|ref|ZP_04410608.1| hypothetical protein VIF_001712 [Vibrio cholerae TM 11079-80] gi|229341720|gb|EEO06722.1| hypothetical protein VIF_001712 [Vibrio cholerae TM 11079-80] Length = 283 Score = 35.7 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF P F + +A Q V +++ +I Sbjct: 22 LFDTHCHFDFPPFTAIPELELQKAAQHGVRRLVVPSI 58 >gi|299531555|ref|ZP_07044961.1| TatD-related deoxyribonuclease [Comamonas testosteroni S44] gi|298720518|gb|EFI61469.1| TatD-related deoxyribonuclease [Comamonas testosteroni S44] Length = 278 Score = 35.7 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCH P+F DR V A A V ++ A++ Sbjct: 10 IDTHCHLDAPEFAPDRDAVRAAAQAAGVTHLVIPAVQ 46 >gi|229053886|ref|ZP_04195321.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH603] gi|228721427|gb|EEL72947.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus AH603] Length = 255 Score = 35.7 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVV 36 >gi|315926016|ref|ZP_07922219.1| TatD family hydrolase [Pseudoramibacter alactolyticus ATCC 23263] gi|315620686|gb|EFV00664.1| TatD family hydrolase [Pseudoramibacter alactolyticus ATCC 23263] Length = 257 Score = 35.7 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI++H H F EDR V+ RA A++ +I Sbjct: 3 MLIDSHSHLDDEAFAEDRGAVVARAEAADIGAII 36 >gi|238022071|ref|ZP_04602497.1| hypothetical protein GCWU000324_01976 [Kingella oralis ATCC 51147] gi|237866685|gb|EEP67727.1| hypothetical protein GCWU000324_01976 [Kingella oralis ATCC 51147] Length = 259 Score = 35.7 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH PDF + ++ Q V + +AI++ Sbjct: 3 LIDSHCHINFPDFADRIPELLANMAQNQVAQALAISV 39 >gi|320165849|gb|EFW42748.1| TatD DNase domain containing 3 [Capsaspora owczarzaki ATCC 30864] Length = 395 Score = 35.7 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L++ H H PDF D +V+ RA V + +++ Sbjct: 4 LVDAHVHLAYPDFAHDAASVVERAKAHGVAAALCVSV 40 >gi|227357384|ref|ZP_03841740.1| TatD family deoxyribonuclease [Proteus mirabilis ATCC 29906] gi|227162464|gb|EEI47458.1| TatD family deoxyribonuclease [Proteus mirabilis ATCC 29906] Length = 260 Score = 35.7 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F D N + A QA V K+I Sbjct: 4 FIDTHCHFDFPVFYHDLENSLALAQQAQVKKII 36 >gi|87306362|ref|ZP_01088509.1| putative deoxyribonuclease yabD [Blastopirellula marina DSM 3645] gi|87290541|gb|EAQ82428.1| putative deoxyribonuclease yabD [Blastopirellula marina DSM 3645] Length = 261 Score = 35.7 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 20/44 (45%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTL 44 ML +TH H +V+ RA A V +M+A+ ++ Sbjct: 2 MLFDTHAHLFDETLISQIDDVVARAKAAGVSQMLAVGTTAEDSM 45 >gi|91205054|ref|YP_537409.1| putative deoxyribonuclease TatD [Rickettsia bellii RML369-C] gi|91068598|gb|ABE04320.1| Putative deoxyribonuclease TatD [Rickettsia bellii RML369-C] Length = 287 Score = 35.7 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI++HCH L D + ++I +A + NV + I+ K+ Sbjct: 1 MLIDSHCHLNLLK-DVEIDDIIKQAIENNVQYLQTISTKL 39 >gi|325295276|ref|YP_004281790.1| hydrolase, TatD family [Desulfurobacterium thermolithotrophum DSM 11699] gi|325065724|gb|ADY73731.1| hydrolase, TatD family [Desulfurobacterium thermolithotrophum DSM 11699] Length = 462 Score = 35.7 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVI 22 +I+TH H P FDEDR +I Sbjct: 1 MIDTHAHLHFPQFDEDREEII 21 >gi|262190314|ref|ZP_06048580.1| putative deoxyribonuclease YjjV [Vibrio cholerae CT 5369-93] gi|262033798|gb|EEY52272.1| putative deoxyribonuclease YjjV [Vibrio cholerae CT 5369-93] Length = 284 Score = 35.7 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF P F + +A Q V +++ +I Sbjct: 13 LFDTHCHFDFPPFTATPELELRKAAQHGVRRLVVPSI 49 >gi|254508275|ref|ZP_05120398.1| putative deoxyribonuclease TatD [Vibrio parahaemolyticus 16] gi|219548792|gb|EED25794.1| putative deoxyribonuclease TatD [Vibrio parahaemolyticus 16] Length = 253 Score = 35.7 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR +V+ RA + V K++ Sbjct: 1 MIDTHAHIYASEFDHDRDDVVRRALEQGVEKIL 33 >gi|160901542|ref|YP_001567123.1| TatD family hydrolase [Petrotoga mobilis SJ95] gi|160359186|gb|ABX30800.1| hydrolase, TatD family [Petrotoga mobilis SJ95] Length = 255 Score = 35.7 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 I+THCH LL FD+DR ++ +A++ + +I I I V + Sbjct: 3 FIDTHCHLLLKQFDDDRQEMLKKANEE-LDLLIEIGINVESS 43 >gi|325569333|ref|ZP_08145489.1| TatD family hydrolase [Enterococcus casseliflavus ATCC 12755] gi|325157333|gb|EGC69494.1| TatD family hydrolase [Enterococcus casseliflavus ATCC 12755] Length = 256 Score = 35.7 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M+ ++H H F+ED + RAH+ V +M + Sbjct: 1 MIFDSHTHLNAEQFNEDIPETVARAHELGVTEMAVV 36 >gi|330860106|emb|CBX70430.1| uncharacterized deoxyribonuclease yjjV [Yersinia enterocolitica W22703] Length = 274 Score = 35.7 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 I+THCHF P F ++ A QANV ++I A+ Sbjct: 11 FIDTHCHFDFPPFRGAEVASLLSAGQANVKQIIVPAV 47 >gi|310778147|ref|YP_003966480.1| hydrolase, TatD family [Ilyobacter polytropus DSM 2926] gi|309747470|gb|ADO82132.1| hydrolase, TatD family [Ilyobacter polytropus DSM 2926] Length = 254 Score = 35.7 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMR 24 LI++HCH F DR +I + Sbjct: 3 LIDSHCHLDNEKFQGDRDEIIEK 25 >gi|296116330|ref|ZP_06834946.1| hydrolase, TatD family protein [Gluconacetobacter hansenii ATCC 23769] gi|295977149|gb|EFG83911.1| hydrolase, TatD family protein [Gluconacetobacter hansenii ATCC 23769] Length = 265 Score = 35.7 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 L ++HCH DE+ +++ RA A V ++ I ++ R Sbjct: 6 LTDSHCHLDHFS-DEELPDLLSRACAAGVSGLVTIGTRLSR 45 >gi|209696397|ref|YP_002264328.1| TatD related DNase [Aliivibrio salmonicida LFI1238] gi|208010351|emb|CAQ80687.1| TatD related DNase [Aliivibrio salmonicida LFI1238] Length = 265 Score = 35.7 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 22/34 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ++I+TH H +FD+DR V+ RA + + +++ Sbjct: 12 IMIDTHAHIYAKEFDDDRDAVVQRALEQGINQIL 45 >gi|71907816|ref|YP_285403.1| TatD-related deoxyribonuclease [Dechloromonas aromatica RCB] gi|71847437|gb|AAZ46933.1| TatD-related deoxyribonuclease [Dechloromonas aromatica RCB] Length = 257 Score = 35.7 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 18/41 (43%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH PD +V+ V + I + + Sbjct: 1 MLVDSHCHLDFPDLANRLPDVLRHMQDNQVGLAVCIGVNLE 41 >gi|330987732|gb|EGH85835.1| TatD family hydrolase [Pseudomonas syringae pv. lachrymans str. M301315] Length = 266 Score = 35.7 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+TH H DFD DR V+ +V +++ + + Sbjct: 5 LIDTHTHLDFADFDADRAQVLDSCLALDVQRIVVLGV 41 >gi|329113411|ref|ZP_08242192.1| Putative deoxyribonuclease [Acetobacter pomorum DM001] gi|326697236|gb|EGE48896.1| Putative deoxyribonuclease [Acetobacter pomorum DM001] Length = 270 Score = 35.7 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 LI++HCH E+ ++ A A + M+ I ++ R Sbjct: 12 LIDSHCHLDHFS-AEEMPELLEAAKDAGLGGMVTIGTRLAR 51 >gi|299536737|ref|ZP_07050047.1| putative deoxyribonuclease yabD [Lysinibacillus fusiformis ZC1] gi|298727851|gb|EFI68416.1| putative deoxyribonuclease yabD [Lysinibacillus fusiformis ZC1] Length = 256 Score = 35.7 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA---IKVIRTLFL 46 M I+TH H ++ED VI RA +A V +M+ I + RT+ L Sbjct: 1 MYIDTHVHLNADQYEEDLQEVIDRALEAKVERMVVIGFDRKTIERTMQL 49 >gi|264676983|ref|YP_003276889.1| TatD-related deoxyribonuclease [Comamonas testosteroni CNB-2] gi|262207495|gb|ACY31593.1| TatD-related deoxyribonuclease [Comamonas testosteroni CNB-2] Length = 278 Score = 35.7 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCH P+F DR V A A V ++ A++ Sbjct: 10 IDTHCHLDAPEFAPDRDAVRAAAQAAGVTHLVIPAVQ 46 >gi|239814252|ref|YP_002943162.1| TatD-related deoxyribonuclease [Variovorax paradoxus S110] gi|239800829|gb|ACS17896.1| TatD-related deoxyribonuclease [Variovorax paradoxus S110] Length = 286 Score = 35.7 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 21/40 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 + ++THCH P+F + V RA + V+ + A+ V Sbjct: 3 VFVDTHCHLDAPEFGAEMPLVRARAAERGVVLCVIPAVAV 42 >gi|149193690|ref|ZP_01870788.1| TatD-related deoxyribonuclease [Caminibacter mediatlanticus TB-2] gi|149135643|gb|EDM24121.1| TatD-related deoxyribonuclease [Caminibacter mediatlanticus TB-2] Length = 249 Score = 35.7 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+TH H F +D VI RA + V K I Sbjct: 1 MIIDTHTHLDNQKFIDDIDEVIKRAKEVGVEKFI 34 >gi|193215312|ref|YP_001996511.1| hydrolase [Chloroherpeton thalassium ATCC 35110] gi|193088789|gb|ACF14064.1| hydrolase, TatD family [Chloroherpeton thalassium ATCC 35110] Length = 260 Score = 35.7 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 19/43 (44%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 M ++ HCH P F +D +VI R V ++ V + Sbjct: 1 MFVDAHCHLAFPQFAQDLGDVIDRMKANRVGLLLHPGTGVETS 43 >gi|222056377|ref|YP_002538739.1| hydrolase, TatD family [Geobacter sp. FRC-32] gi|221565666|gb|ACM21638.1| hydrolase, TatD family [Geobacter sp. FRC-32] Length = 462 Score = 35.7 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 24/39 (61%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 LI++H H P+F +D +++ RA +A V ++I + V Sbjct: 7 LIDSHAHIYGPEFKDDFADMLKRAEEAGVSEIIVVGTDV 45 >gi|218264433|ref|ZP_03478284.1| hypothetical protein PRABACTJOHN_03980 [Parabacteroides johnsonii DSM 18315] gi|218222006|gb|EEC94656.1| hypothetical protein PRABACTJOHN_03980 [Parabacteroides johnsonii DSM 18315] Length = 262 Score = 35.7 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+TH H L DFD ++ ++ A ++ + ++ Sbjct: 3 LIDTHNHLYLEDFDPEQDQLVTAAKKSGIDTLL 35 >gi|160889239|ref|ZP_02070242.1| hypothetical protein BACUNI_01661 [Bacteroides uniformis ATCC 8492] gi|156861246|gb|EDO54677.1| hypothetical protein BACUNI_01661 [Bacteroides uniformis ATCC 8492] Length = 259 Score = 35.7 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 LI++H H L +F ED V+ RA +A V + Sbjct: 3 LIDSHSHLFLEEFAEDLPQVMARAREAGVTHI 34 >gi|294650546|ref|ZP_06727903.1| magnesium (Mg2+)-dependent deoxyribonuclease [Acinetobacter haemolyticus ATCC 19194] gi|292823543|gb|EFF82389.1| magnesium (Mg2+)-dependent deoxyribonuclease [Acinetobacter haemolyticus ATCC 19194] Length = 257 Score = 35.7 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 1 MLINTHCHF---LLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M ++THCH L +D D + +A A V K + I++ Sbjct: 1 MFVDTHCHLTMLDLSPYDGDLDQALAQARLAGVSKFMGISV 41 >gi|27365082|ref|NP_760610.1| putative deoxyribonuclease YjjV [Vibrio vulnificus CMCP6] gi|27361228|gb|AAO10137.1| Putative deoxyribonuclease YjjV [Vibrio vulnificus CMCP6] Length = 265 Score = 35.7 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 16/33 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCH F+ R + R + V +++ Sbjct: 3 LFDTHCHLDFDVFEPARSQHLQRGLEVGVERLL 35 >gi|46581604|ref|YP_012412.1| TatD family hydrolase [Desulfovibrio vulgaris str. Hildenborough] gi|120601236|ref|YP_965636.1| TatD family hydrolase [Desulfovibrio vulgaris DP4] gi|46451027|gb|AAS97672.1| hydrolase, TatD family [Desulfovibrio vulgaris str. Hildenborough] gi|120561465|gb|ABM27209.1| hydrolase, TatD family [Desulfovibrio vulgaris DP4] gi|311235247|gb|ADP88101.1| hydrolase, TatD family [Desulfovibrio vulgaris RCH1] Length = 278 Score = 35.3 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 18/31 (58%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 + +H H L F ED +V+ RA QA + +M Sbjct: 21 VESHAHLDLDAFAEDLGDVLQRAQQAGIARM 51 >gi|295084867|emb|CBK66390.1| Mg-dependent DNase [Bacteroides xylanisolvens XB1A] Length = 248 Score = 35.3 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANV 30 MLI+TH H + +F ED V+ RA +A V Sbjct: 1 MLIDTHSHLFVEEFIEDLPQVMERARKAGV 30 >gi|257094044|ref|YP_003167685.1| TatD family hydrolase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] gi|257046568|gb|ACV35756.1| hydrolase, TatD family [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] Length = 260 Score = 35.3 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 17/41 (41%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH P+ +I V + I + + Sbjct: 1 MLVDSHCHLDFPELAARLPAIIDLMTSNGVGCAVCIGVTLE 41 >gi|123440936|ref|YP_001004926.1| putative metalloenzyme [Yersinia enterocolitica subsp. enterocolitica 8081] gi|122087897|emb|CAL10685.1| putative metalloenzyme [Yersinia enterocolitica subsp. enterocolitica 8081] Length = 265 Score = 35.3 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 21/37 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 I+THCHF P F ++ A QANV ++I A+ Sbjct: 4 FIDTHCHFDFPPFRGAEVASLLSAGQANVRQIIVPAV 40 >gi|90412501|ref|ZP_01220504.1| hypothetical protein P3TCK_14053 [Photobacterium profundum 3TCK] gi|90326538|gb|EAS42944.1| hypothetical protein P3TCK_14053 [Photobacterium profundum 3TCK] Length = 264 Score = 35.3 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI++HCHF F + + + A A V ++I Sbjct: 1 MLIDSHCHFDFAPFIDAPEHYLTLAKDAGVKRII 34 >gi|294778250|ref|ZP_06743676.1| hydrolase, TatD family [Bacteroides vulgatus PC510] gi|294447878|gb|EFG16452.1| hydrolase, TatD family [Bacteroides vulgatus PC510] Length = 257 Score = 35.3 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 +I+TH H + +FDED VI RA + V K+ Sbjct: 1 MIDTHSHLFVEEFDEDLPAVIERARDSGVSKV 32 >gi|187735324|ref|YP_001877436.1| TatD-related deoxyribonuclease [Akkermansia muciniphila ATCC BAA-835] gi|187425376|gb|ACD04655.1| TatD-related deoxyribonuclease [Akkermansia muciniphila ATCC BAA-835] Length = 271 Score = 35.3 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNV-IMRAHQANVLKMIAIAIKV 40 M+I+THCH FD+ R + A + + +MI + ++ Sbjct: 1 MIIDTHCHLASAQFDQSRRETYVQHALREGIDRMITLGARM 41 >gi|229542294|ref|ZP_04431354.1| hydrolase, TatD family [Bacillus coagulans 36D1] gi|229326714|gb|EEN92389.1| hydrolase, TatD family [Bacillus coagulans 36D1] Length = 276 Score = 35.3 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F +D I RA +A V KM + Sbjct: 19 MLFDTHVHINDEAFKDDLEATIARAREAGVEKMTVV 54 >gi|320155466|ref|YP_004187845.1| putative deoxyribonuclease YjjV [Vibrio vulnificus MO6-24/O] gi|319930778|gb|ADV85642.1| putative deoxyribonuclease YjjV [Vibrio vulnificus MO6-24/O] Length = 265 Score = 35.3 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 16/33 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCH F+ R + R + V +++ Sbjct: 3 LFDTHCHLDFDVFEPARSQHLQRGLEVGVERLL 35 >gi|304413839|ref|ZP_07395256.1| putative metallodependent hydrolase [Candidatus Regiella insecticola LSR1] gi|304283559|gb|EFL91954.1| putative metallodependent hydrolase [Candidatus Regiella insecticola LSR1] Length = 267 Score = 35.3 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Query: 1 MLINTHCHFLLPDFD---EDRHNVIMRAHQANVLKMIAIAI 38 +LI++HCH D+ D +V+ +A V ++A+A Sbjct: 2 LLIDSHCHLDSLDYQQLHADVDDVLAKAKARGVGFVLAVAT 42 >gi|254490579|ref|ZP_05103765.1| hydrolase, TatD family [Methylophaga thiooxidans DMS010] gi|224464323|gb|EEF80586.1| hydrolase, TatD family [Methylophaga thiooxydans DMS010] Length = 254 Score = 35.3 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI++HCH FD DR V+ R + + +I Sbjct: 4 LIDSHCHLDFHTFDHDREAVLSRCVEQEIRDII 36 >gi|325959852|ref|YP_004291318.1| hydrolase, TatD family [Methanobacterium sp. AL-21] gi|325331284|gb|ADZ10346.1| hydrolase, TatD family [Methanobacterium sp. AL-21] Length = 252 Score = 35.3 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 18/26 (69%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 +I+THCH +++++R V+ RA + Sbjct: 1 MIDTHCHVDFKEYNKNREEVMERAKK 26 >gi|84489975|ref|YP_448207.1| DNase [Methanosphaera stadtmanae DSM 3091] gi|84373294|gb|ABC57564.1| predicted DNase [Methanosphaera stadtmanae DSM 3091] Length = 252 Score = 35.3 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 +I+THCH +FD R +I + Sbjct: 1 MIDTHCHLSFEEFDNKREEIIENTRK 26 >gi|270295969|ref|ZP_06202169.1| conserved hypothetical protein [Bacteroides sp. D20] gi|270273373|gb|EFA19235.1| conserved hypothetical protein [Bacteroides sp. D20] Length = 259 Score = 35.3 bits (80), Expect = 2.6, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 LI++H H L +F ED V+ RA +A V + Sbjct: 3 LIDSHSHLFLEEFAEDLPQVMARAREAGVTHI 34 >gi|224536143|ref|ZP_03676682.1| hypothetical protein BACCELL_01008 [Bacteroides cellulosilyticus DSM 14838] gi|224522225|gb|EEF91330.1| hypothetical protein BACCELL_01008 [Bacteroides cellulosilyticus DSM 14838] Length = 259 Score = 35.3 bits (80), Expect = 2.6, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 18/32 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 LI+TH H L +F ED VI RA A V + Sbjct: 3 LIDTHSHLFLEEFSEDFPQVIERARAAGVTHI 34 >gi|254882775|ref|ZP_05255485.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA] gi|254835568|gb|EET15877.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA] Length = 257 Score = 35.3 bits (80), Expect = 2.6, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 +I+TH H + +FDED VI RA + V K+ Sbjct: 1 MIDTHSHLFVEEFDEDLPAVIERARDSGVSKV 32 >gi|156972892|ref|YP_001443799.1| deoxyribonuclease [Vibrio harveyi ATCC BAA-1116] gi|156524486|gb|ABU69572.1| hypothetical protein VIBHAR_00569 [Vibrio harveyi ATCC BAA-1116] Length = 254 Score = 35.3 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA + + K++ Sbjct: 1 MIDTHAHIYASEFDNDRDEVVKRALEQGIDKIL 33 >gi|90021299|ref|YP_527126.1| ATPase [Saccharophagus degradans 2-40] gi|89950899|gb|ABD80914.1| TatD-related deoxyribonuclease [Saccharophagus degradans 2-40] Length = 258 Score = 35.3 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Query: 1 MLINTHCHFLLPD---FDEDRHNVIMRAHQANVLKMIAIAI 38 ML+++HCH D +++ I A + V M+ + I Sbjct: 1 MLVDSHCHLDRLDLSRYEDGLDGAIAAAKEQGVKTMLCVCI 41 >gi|189463878|ref|ZP_03012663.1| hypothetical protein BACINT_00212 [Bacteroides intestinalis DSM 17393] gi|189438451|gb|EDV07436.1| hypothetical protein BACINT_00212 [Bacteroides intestinalis DSM 17393] Length = 259 Score = 35.3 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 18/32 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 LI+TH H L +F ED VI RA A V + Sbjct: 3 LIDTHSHLFLEEFSEDLPQVIERARSAGVTHI 34 >gi|262374964|ref|ZP_06068198.1| Mg-dependent DNase [Acinetobacter lwoffii SH145] gi|262309977|gb|EEY91106.1| Mg-dependent DNase [Acinetobacter lwoffii SH145] Length = 273 Score = 35.3 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 19/35 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF +PDFD DR + A V ++ I Sbjct: 5 LFDTHTHFDVPDFDPDREQLAYAAKVTGVEHLVLI 39 >gi|238028007|ref|YP_002912238.1| TatD-related deoxyribonuclease [Burkholderia glumae BGR1] gi|237877201|gb|ACR29534.1| TatD-related deoxyribonuclease [Burkholderia glumae BGR1] Length = 262 Score = 35.3 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH +FD DR V A A V ++ Sbjct: 1 MWIDTHCHLDAGEFDADRDAVACAARAAGVSGIV 34 >gi|261346492|ref|ZP_05974136.1| hydrogenase nickel insertion protein HypA [Providencia rustigianii DSM 4541] gi|282565482|gb|EFB71017.1| hydrogenase nickel insertion protein HypA [Providencia rustigianii DSM 4541] Length = 261 Score = 35.3 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F + + A QA + +I Sbjct: 7 FIDTHCHFDFPPFSDSYPENLELAKQAGITDII 39 >gi|255659103|ref|ZP_05404512.1| hydrolase, TatD family [Mitsuokella multacida DSM 20544] gi|260848547|gb|EEX68554.1| hydrolase, TatD family [Mitsuokella multacida DSM 20544] Length = 258 Score = 35.3 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L++TH H F +D + RA A V +M+ + Sbjct: 5 LVDTHTHLNDAKFQDDVKETVERARAAGVTRMVNM 39 >gi|154491789|ref|ZP_02031415.1| hypothetical protein PARMER_01405 [Parabacteroides merdae ATCC 43184] gi|154088030|gb|EDN87075.1| hypothetical protein PARMER_01405 [Parabacteroides merdae ATCC 43184] Length = 262 Score = 35.3 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI+TH H L DFD ++ ++ A ++ + ++ Sbjct: 3 LIDTHNHLYLEDFDPEQDQLVTIAKESGIDTLL 35 >gi|150004491|ref|YP_001299235.1| hypothetical protein BVU_1940 [Bacteroides vulgatus ATCC 8482] gi|149932915|gb|ABR39613.1| conserved hypothetical protein [Bacteroides vulgatus ATCC 8482] Length = 257 Score = 35.3 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 +I+TH H + +FDED VI RA + V K+ Sbjct: 1 MIDTHSHLFVEEFDEDLPAVIERARDSGVSKV 32 >gi|54297312|ref|YP_123681.1| hypothetical protein lpp1357 [Legionella pneumophila str. Paris] gi|53751097|emb|CAH12508.1| hypothetical protein lpp1357 [Legionella pneumophila str. Paris] Length = 262 Score = 35.3 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Query: 1 MLINTHCHFLLPD---FDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH D F+ D VI +A + V +++ +++ Sbjct: 1 MLVDSHCHLNFIDLTHFNHDLAQVINQARENGVEHFLSVCVEL 43 >gi|319643917|ref|ZP_07998492.1| hypothetical protein HMPREF9011_04095 [Bacteroides sp. 3_1_40A] gi|317384441|gb|EFV65408.1| hypothetical protein HMPREF9011_04095 [Bacteroides sp. 3_1_40A] Length = 257 Score = 35.3 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 +I+TH H + +FDED VI RA + V K+ Sbjct: 1 MIDTHSHLFVEEFDEDLPAVIERARDSGVSKV 32 >gi|229188325|ref|ZP_04315374.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus ATCC 10876] gi|228595124|gb|EEK52894.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus ATCC 10876] Length = 255 Score = 35.3 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVISRMKEAGVTYTVVV 36 >gi|39998376|ref|NP_954327.1| TatD family hydrolase [Geobacter sulfurreducens PCA] gi|39985322|gb|AAR36677.1| hydrolase, TatD family [Geobacter sulfurreducens PCA] Length = 258 Score = 35.3 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +L +THCH P V+ A A V ++I Sbjct: 4 LLTDTHCHLDAPPLRGRLDEVLASARHAGVDRII 37 >gi|226952964|ref|ZP_03823428.1| TatD family hydrolase [Acinetobacter sp. ATCC 27244] gi|226836285|gb|EEH68668.1| TatD family hydrolase [Acinetobacter sp. ATCC 27244] Length = 257 Score = 35.3 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 1 MLINTHCHF---LLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M ++THCH L +D D + +A A V K + I++ Sbjct: 1 MFVDTHCHLTMLDLSPYDGDLDQALAQARLAGVSKFMGISV 41 >gi|148358933|ref|YP_001250140.1| deoxyribonuclease TatD [Legionella pneumophila str. Corby] gi|296106981|ref|YP_003618681.1| Mg-dependent DNase [Legionella pneumophila 2300/99 Alcoy] gi|148280706|gb|ABQ54794.1| deoxyribonuclease TatD [Legionella pneumophila str. Corby] gi|295648882|gb|ADG24729.1| Mg-dependent DNase [Legionella pneumophila 2300/99 Alcoy] Length = 262 Score = 35.3 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Query: 1 MLINTHCHFLLPD---FDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH D F+ D VI +A + V +++ +++ Sbjct: 1 MLVDSHCHLNFIDLTHFNHDLAQVINQARENGVEHFLSVCVEL 43 >gi|187928508|ref|YP_001898995.1| hydrolase, TatD family [Ralstonia pickettii 12J] gi|187725398|gb|ACD26563.1| hydrolase, TatD family [Ralstonia pickettii 12J] Length = 267 Score = 35.3 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 19/41 (46%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH PD ++ R + V + I++ + Sbjct: 1 MFVDSHCHINFPDLRARLPELLTRMRENRVTHALCISVTLE 41 >gi|309782018|ref|ZP_07676748.1| hydrolase, TatD family [Ralstonia sp. 5_7_47FAA] gi|308919084|gb|EFP64751.1| hydrolase, TatD family [Ralstonia sp. 5_7_47FAA] Length = 267 Score = 35.3 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 19/41 (46%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH PD ++ R + V + I++ + Sbjct: 1 MFVDSHCHINFPDLRARLPELLTRMRENRVTHALCISVTLE 41 >gi|261253787|ref|ZP_05946360.1| putative deoxyribonuclease YjjV [Vibrio orientalis CIP 102891] gi|260937178|gb|EEX93167.1| putative deoxyribonuclease YjjV [Vibrio orientalis CIP 102891] Length = 257 Score = 35.3 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF F D + A+ V + + +I Sbjct: 3 LFDTHCHFDFDIFQGDFDAQLKSANAQGVSRFVVPSI 39 >gi|117924394|ref|YP_865011.1| TatD-related deoxyribonuclease [Magnetococcus sp. MC-1] gi|117608150|gb|ABK43605.1| TatD-related deoxyribonuclease [Magnetococcus sp. MC-1] Length = 252 Score = 35.3 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCH P + V+ R+ A V + + Sbjct: 1 MIDTHCHLDDPHLYQRLEAVLSRSRAAGVSQWV 33 >gi|327262430|ref|XP_003216027.1| PREDICTED: putative deoxyribonuclease TATDN3-like [Anolis carolinensis] Length = 269 Score = 35.3 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 22/35 (62%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ++ HCH P+F+ D V+ A ++ +L ++A+A Sbjct: 4 VDCHCHLAAPEFEGDIECVLEEARKSKLLALVAVA 38 >gi|119468960|ref|ZP_01611985.1| putative hydrolase with metallo-dependent hydrolase domain [Alteromonadales bacterium TW-7] gi|119447612|gb|EAW28879.1| putative hydrolase with metallo-dependent hydrolase domain [Alteromonadales bacterium TW-7] Length = 255 Score = 35.3 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 16/33 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I++HCH +FD R ++I V + + Sbjct: 3 FIDSHCHLDFSEFDSIRESLINECIAKGVNQFV 35 >gi|83588922|ref|YP_428931.1| TatD-related deoxyribonuclease [Moorella thermoacetica ATCC 39073] gi|83571836|gb|ABC18388.1| TatD-related deoxyribonuclease [Moorella thermoacetica ATCC 39073] Length = 256 Score = 35.3 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 LI++H H P F D V+ R QA V+ ++ Sbjct: 4 LIDSHAHLNDPAFAGDLDQVMARLEQAGVVGLV 36 >gi|189485354|ref|YP_001956295.1| TatD-related deoxyribonuclease [uncultured Termite group 1 bacterium phylotype Rs-D17] gi|170287313|dbj|BAG13834.1| TatD-related deoxyribonuclease [uncultured Termite group 1 bacterium phylotype Rs-D17] Length = 254 Score = 35.3 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 22/41 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M+I+TH H FD DR VI +A + K+ IA ++ Sbjct: 1 MIIDTHAHMSDSRFDNDREIVIQKAFDCGIEKIFEIACEMR 41 >gi|329961530|ref|ZP_08299611.1| hydrolase, TatD family [Bacteroides fluxus YIT 12057] gi|328531742|gb|EGF58571.1| hydrolase, TatD family [Bacteroides fluxus YIT 12057] Length = 259 Score = 35.3 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 LI++H H L +F ED V+ RA +A V + Sbjct: 3 LIDSHSHLFLEEFAEDLPQVMERAREAGVTHI 34 >gi|149369622|ref|ZP_01889474.1| tatD-related DNase [unidentified eubacterium SCB49] gi|149357049|gb|EDM45604.1| tatD-related DNase [unidentified eubacterium SCB49] Length = 254 Score = 35.3 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 17/32 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 ML +TH H FD DR ++ RA A V + Sbjct: 1 MLTDTHTHLYSDAFDSDRDEMMQRAIDAGVTR 32 >gi|37680865|ref|NP_935474.1| Mg-dependent DNase [Vibrio vulnificus YJ016] gi|37199614|dbj|BAC95445.1| Mg-dependent DNase [Vibrio vulnificus YJ016] Length = 279 Score = 35.3 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 16/33 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCH F+ R + R + V +++ Sbjct: 17 LFDTHCHLDFDVFEPARSQHLQRGLEVGVERLL 49 >gi|313682558|ref|YP_004060296.1| hydrolase, tatd family [Sulfuricurvum kujiense DSM 16994] gi|313155418|gb|ADR34096.1| hydrolase, TatD family [Sulfuricurvum kujiense DSM 16994] Length = 258 Score = 35.3 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+TH H + ED ++ RA +A V I Sbjct: 1 MIIDTHVHLDDERYREDFDAMMARAREAGVEAFI 34 >gi|283797636|ref|ZP_06346789.1| deoxyribonuclease, TatD family [Clostridium sp. M62/1] gi|291074748|gb|EFE12112.1| deoxyribonuclease, TatD family [Clostridium sp. M62/1] Length = 260 Score = 35.3 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 21/36 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M+ +TH H+ FDEDR V+M +A V ++ + Sbjct: 1 MIFDTHAHYDDEAFDEDRDRVLMGLKEAGVGTVLNV 36 >gi|54307831|ref|YP_128851.1| hypothetical protein PBPRA0628 [Photobacterium profundum SS9] gi|46912254|emb|CAG19049.1| hypothetical protein PBPRA0628 [Photobacterium profundum SS9] Length = 302 Score = 35.3 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI++HCHF F + + + A A V +++ Sbjct: 39 MLIDSHCHFDFAPFIDAPEHYLTLAKNAGVKRIV 72 >gi|261492951|ref|ZP_05989496.1| putative deoxyribonuclease [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261495094|ref|ZP_05991560.1| putative deoxyribonuclease [Mannheimia haemolytica serotype A2 str. OVINE] gi|261309260|gb|EEY10497.1| putative deoxyribonuclease [Mannheimia haemolytica serotype A2 str. OVINE] gi|261311403|gb|EEY12561.1| putative deoxyribonuclease [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 262 Score = 35.3 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAIKVIR 42 +I++HCH D++ VI A V I++ V R Sbjct: 6 IIDSHCHLDSLDYETRHKNVDEVIENAKARGVHHFISVCTTVGR 49 >gi|330722493|gb|EGH00320.1| Putative deoxyribonuclease YcfH [gamma proteobacterium IMCC2047] Length = 259 Score = 35.3 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Query: 1 MLINTHCH---FLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH L ++ D + I AH V M+ +AI + + Sbjct: 1 MLVDSHCHLDRLDLAPYNGDLNKAITAAHDEGVDHMLCVAISLAK 45 >gi|152973887|ref|YP_001373404.1| TatD family hydrolase [Bacillus cereus subsp. cytotoxis NVH 391-98] gi|152022639|gb|ABS20409.1| hydrolase, TatD family [Bacillus cytotoxicus NVH 391-98] Length = 255 Score = 35.3 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 17/36 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI R + V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIARMKETGVAYTVVV 36 >gi|308270492|emb|CBX27104.1| hypothetical protein N47_A11330 [uncultured Desulfobacterium sp.] Length = 262 Score = 35.3 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 26/41 (63%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTL 44 ++HCH +D+D +V+ RA +A V+K++ + I + ++ Sbjct: 5 DSHCHLDDRAYDKDLGSVVNRAKKAGVVKIMIVGIDMKSSV 45 >gi|254724180|ref|ZP_05185965.1| deoxyribonuclease, TatD family protein [Bacillus anthracis str. A1055] Length = 255 Score = 35.3 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI+R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIVRMKEAGVTYTVVV 36 >gi|240948825|ref|ZP_04753181.1| Putative Mg-dependent DNAse [Actinobacillus minor NM305] gi|240296640|gb|EER47251.1| Putative Mg-dependent DNAse [Actinobacillus minor NM305] Length = 262 Score = 35.3 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAIKVIR 42 +I++HCH D++ VI A + V ++++ + R Sbjct: 6 IIDSHCHLDALDYETRHKNVDEVIENAKKRGVQHILSVCTTLGR 49 >gi|297280816|ref|XP_001106148.2| PREDICTED: putative deoxyribonuclease TATDN3-like [Macaca mulatta] Length = 269 Score = 34.9 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQ 27 L++ HCH PDFD D +V+ +A + Sbjct: 8 LVDCHCHISAPDFDRDLDDVLEKAKK 33 >gi|241663062|ref|YP_002981422.1| hydrolase, TatD family [Ralstonia pickettii 12D] gi|240865089|gb|ACS62750.1| hydrolase, TatD family [Ralstonia pickettii 12D] Length = 267 Score = 34.9 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 19/41 (46%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH PD ++ R + V + I++ + Sbjct: 1 MFVDSHCHINFPDLRARLPELLTRMRENRVTHALCISVTLE 41 >gi|307610106|emb|CBW99647.1| hypothetical protein LPW_14151 [Legionella pneumophila 130b] Length = 262 Score = 34.9 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Query: 1 MLINTHCHFLLPD---FDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH D F+ D VI +A + V +++ +++ Sbjct: 1 MLVDSHCHLNFIDLTHFNHDLAQVINQARENGVEHFLSVCVEL 43 >gi|229159213|ref|ZP_04287238.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus R309803] gi|228624228|gb|EEK81029.1| Uncharacterized deoxyribonuclease yabD [Bacillus cereus R309803] Length = 255 Score = 34.9 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI+R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEEDLQEVIVRMKEAGVTYTVVV 36 >gi|323344511|ref|ZP_08084736.1| TatD family deoxyribonuclease [Prevotella oralis ATCC 33269] gi|323094638|gb|EFZ37214.1| TatD family deoxyribonuclease [Prevotella oralis ATCC 33269] Length = 285 Score = 34.9 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 22/41 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 + I+TH H +F +D +V+ RA +A V K AI + Sbjct: 4 IFIDTHAHLDGEEFRQDIEDVVARARKAGVSKAFIPAIDLK 44 >gi|294055347|ref|YP_003549005.1| hydrolase, TatD family [Coraliomargarita akajimensis DSM 45221] gi|293614680|gb|ADE54835.1| hydrolase, TatD family [Coraliomargarita akajimensis DSM 45221] Length = 265 Score = 34.9 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 LI++HCH L + H ++ R+ +A+V + I + + Sbjct: 3 LIDSHCHLLGFQQKGELHAMMQRSREADVCRFITVGTGLK 42 >gi|16329958|ref|NP_440686.1| hypothetical protein sll1786 [Synechocystis sp. PCC 6803] gi|2501548|sp|P73335|Y1786_SYNY3 RecName: Full=Uncharacterized deoxyribonuclease sll1786 gi|1652444|dbj|BAA17366.1| sll1786 [Synechocystis sp. PCC 6803] Length = 261 Score = 34.9 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 19/38 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 L++TH H F D + R QA V++++ +K Sbjct: 3 LVDTHVHINFDVFAADLDQLQHRWRQAGVVQLVHSCVK 40 >gi|219847701|ref|YP_002462134.1| hydrolase, TatD family [Chloroflexus aggregans DSM 9485] gi|219541960|gb|ACL23698.1| hydrolase, TatD family [Chloroflexus aggregans DSM 9485] Length = 271 Score = 34.9 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 18/35 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 I+TH H FD+DR VI RA V +I I Sbjct: 15 FIDTHLHLASVQFDDDRSEVITRALDTGVAALIEI 49 >gi|304382637|ref|ZP_07365131.1| TatD family deoxyribonuclease [Prevotella marshii DSM 16973] gi|304336262|gb|EFM02504.1| TatD family deoxyribonuclease [Prevotella marshii DSM 16973] Length = 265 Score = 34.9 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 20/32 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 +I+TH H +F+ED V+ RA +A V K+ Sbjct: 3 MIDTHAHLDGEEFNEDLSEVVERALKAGVNKV 34 >gi|257465289|ref|ZP_05629660.1| Putative Mg-dependent DNAse [Actinobacillus minor 202] gi|257450949|gb|EEV24992.1| Putative Mg-dependent DNAse [Actinobacillus minor 202] Length = 262 Score = 34.9 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAIKVIR 42 +I++HCH D++ VI A + V ++++ + R Sbjct: 6 IIDSHCHLDALDYETRHKNVDEVIENAKKRGVQHILSVCTTLGR 49 >gi|255534885|ref|YP_003095256.1| Putative deoxyribonuclease YcfH [Flavobacteriaceae bacterium 3519-10] gi|255341081|gb|ACU07194.1| Putative deoxyribonuclease YcfH [Flavobacteriaceae bacterium 3519-10] Length = 257 Score = 34.9 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 +I+TH H +F DR +I RA A V K Sbjct: 1 MIDTHTHLYSEEFSSDRDEMIQRAVAAGVTK 31 >gi|254282818|ref|ZP_04957786.1| hydrolase, TatD family [gamma proteobacterium NOR51-B] gi|219679021|gb|EED35370.1| hydrolase, TatD family [gamma proteobacterium NOR51-B] Length = 271 Score = 34.9 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI THCH D D I AH+ V +++ IA+ Sbjct: 16 LIETHCHLDYLDGDA-LTQTIDEAHRVGVERIVTIAV 51 >gi|289607374|emb|CBI60816.1| unnamed protein product [Sordaria macrospora] Length = 204 Score = 34.9 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 19/38 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 L ++HCH E + +V+ RA V+ + I+ + Sbjct: 3 LADSHCHLNYKGVAEVQGDVLARARDTGVVAFLNISTR 40 >gi|254499171|ref|ZP_05111852.1| deoxyribonuclease TatD [Legionella drancourtii LLAP12] gi|254351605|gb|EET10459.1| deoxyribonuclease TatD [Legionella drancourtii LLAP12] Length = 258 Score = 34.9 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Query: 1 MLINTHCH---FLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 ML+++HCH L DF++D NV+ +A V + + +++ Sbjct: 1 MLVDSHCHLNFLDLTDFNQDMANVLAQAKDNGVQHFLCVCVEL 43 >gi|296273488|ref|YP_003656119.1| TatD family hydrolase [Arcobacter nitrofigilis DSM 7299] gi|296097662|gb|ADG93612.1| hydrolase, TatD family [Arcobacter nitrofigilis DSM 7299] Length = 262 Score = 34.9 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVL 31 M+I+THCH F ED V+ A + + Sbjct: 1 MIIDTHCHLDNEQFYEDVDIVLQTALEKGIK 31 >gi|261209809|ref|ZP_05924111.1| putative deoxyribonuclease YcfH [Vibrio sp. RC341] gi|260841107|gb|EEX67627.1| putative deoxyribonuclease YcfH [Vibrio sp. RC341] Length = 255 Score = 34.9 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Query: 1 MLINTHCHFLLPDFDE---DRHNVIMRAHQANVLKMIAIAI 38 M +++HCH D+ E D +VI +AHQA V ++++ + Sbjct: 1 MFVDSHCHLDKLDYQELHTDVSDVIAKAHQAKVEHLLSVGV 41 >gi|153833799|ref|ZP_01986466.1| hydrolase, TatD family [Vibrio harveyi HY01] gi|148869857|gb|EDL68825.1| hydrolase, TatD family [Vibrio harveyi HY01] Length = 254 Score = 34.9 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA + + +++ Sbjct: 1 MIDTHAHIYASEFDNDRDEVVKRALEQGIDRIL 33 >gi|325300425|ref|YP_004260342.1| hydrolase, TatD family [Bacteroides salanitronis DSM 18170] gi|324319978|gb|ADY37869.1| hydrolase, TatD family [Bacteroides salanitronis DSM 18170] Length = 263 Score = 34.9 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 21/31 (67%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 L++TH H + ++DEDR ++RA QA V + Sbjct: 4 LVDTHTHLFVEEYDEDRELALIRARQAGVTR 34 >gi|310825763|ref|YP_003958120.1| TatD family hydrolase [Eubacterium limosum KIST612] gi|308737497|gb|ADO35157.1| TatD family hydrolase [Eubacterium limosum KIST612] Length = 256 Score = 34.9 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVL 31 ML ++H H F+ + +I A +A + Sbjct: 1 MLADSHAHLDDERFENEVDTIIENAREAGIG 31 >gi|291612809|ref|YP_003522966.1| TatD-related deoxyribonuclease [Sideroxydans lithotrophicus ES-1] gi|291582921|gb|ADE10579.1| TatD-related deoxyribonuclease [Sideroxydans lithotrophicus ES-1] Length = 265 Score = 34.9 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M ++THCH +F + V+ A V ++I Sbjct: 1 MFVDTHCHLDAAEFGGTQTEVVRNAAAVGVNRLI 34 >gi|212709079|ref|ZP_03317207.1| hypothetical protein PROVALCAL_00112 [Providencia alcalifaciens DSM 30120] gi|212687991|gb|EEB47519.1| hypothetical protein PROVALCAL_00112 [Providencia alcalifaciens DSM 30120] Length = 266 Score = 34.9 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F + + + +A + + +I Sbjct: 7 FIDTHCHFDFPPFSDALSDSLEKAAEGGITDII 39 >gi|53715027|ref|YP_101019.1| putative deoxyribonuclease [Bacteroides fragilis YCH46] gi|60682989|ref|YP_213133.1| putative DNAse-like protein [Bacteroides fragilis NCTC 9343] gi|253566125|ref|ZP_04843579.1| conserved hypothetical protein [Bacteroides sp. 3_2_5] gi|265766876|ref|ZP_06094705.1| conserved hypothetical protein [Bacteroides sp. 2_1_16] gi|52217892|dbj|BAD50485.1| putative deoxyribonuclease [Bacteroides fragilis YCH46] gi|60494423|emb|CAH09219.1| putative DNAse related protein [Bacteroides fragilis NCTC 9343] gi|251945229|gb|EES85667.1| conserved hypothetical protein [Bacteroides sp. 3_2_5] gi|263253253|gb|EEZ24729.1| conserved hypothetical protein [Bacteroides sp. 2_1_16] gi|301164454|emb|CBW24012.1| putative DNAse related protein [Bacteroides fragilis 638R] Length = 258 Score = 34.9 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 ML+++H H L +F ED V+ RA A V + Sbjct: 1 MLVDSHSHLFLEEFAEDLPFVMERARAAGVTHI 33 >gi|148264555|ref|YP_001231261.1| TatD family hydrolase [Geobacter uraniireducens Rf4] gi|146398055|gb|ABQ26688.1| hydrolase, TatD family [Geobacter uraniireducens Rf4] Length = 462 Score = 34.9 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 11/42 (26%), Positives = 22/42 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 LI++H H +F D ++ RA +A V ++I + + + Sbjct: 7 LIDSHAHIYGLEFSNDFDEMLQRAAEAGVEQIIVVGTDLETS 48 >gi|121606133|ref|YP_983462.1| TatD-like deoxyribonuclease [Polaromonas naphthalenivorans CJ2] gi|120595102|gb|ABM38541.1| TatD-related deoxyribonuclease [Polaromonas naphthalenivorans CJ2] Length = 282 Score = 34.9 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 I+THCH +F D +V RA V+ + A+ V Sbjct: 5 IDTHCHLDASEFSADLADVRARAAAGGVMHCVLPAVAV 42 >gi|319941020|ref|ZP_08015357.1| hypothetical protein HMPREF9464_00576 [Sutterella wadsworthensis 3_1_45B] gi|319805593|gb|EFW02388.1| hypothetical protein HMPREF9464_00576 [Sutterella wadsworthensis 3_1_45B] Length = 267 Score = 34.9 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 18/35 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 I++HCH P F +D VI R A++ + I Sbjct: 13 FIDSHCHLTDPAFAQDLDAVISRMKNASMTAAVTI 47 >gi|260174036|ref|ZP_05760448.1| hypothetical protein BacD2_19387 [Bacteroides sp. D2] gi|315922305|ref|ZP_07918545.1| conserved hypothetical protein [Bacteroides sp. D2] gi|313696180|gb|EFS33015.1| conserved hypothetical protein [Bacteroides sp. D2] Length = 258 Score = 34.9 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANV 30 MLI+TH H + +F ED V+ RA +A V Sbjct: 1 MLIDTHSHLFVEEFTEDLPLVMERARKAGV 30 >gi|222056898|ref|YP_002539260.1| hydrolase, TatD family [Geobacter sp. FRC-32] gi|221566187|gb|ACM22159.1| hydrolase, TatD family [Geobacter sp. FRC-32] Length = 260 Score = 34.9 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 21/39 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 +LI+THCH P F VI A V+K IA AI+ Sbjct: 5 LLIDTHCHLADPAFAGRLPAVIRAGRMAGVMKFIAPAIE 43 >gi|323493197|ref|ZP_08098327.1| DNase, TatD family protein [Vibrio brasiliensis LMG 20546] gi|323312544|gb|EGA65678.1| DNase, TatD family protein [Vibrio brasiliensis LMG 20546] Length = 253 Score = 34.9 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR +V+ RA + K++ Sbjct: 1 MIDTHAHIYASEFDADRDDVVKRALDQGIDKIL 33 >gi|319793758|ref|YP_004155398.1| hydrolase, tatd family [Variovorax paradoxus EPS] gi|315596221|gb|ADU37287.1| hydrolase, TatD family [Variovorax paradoxus EPS] Length = 270 Score = 34.9 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 18/41 (43%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M ++HCH P+F + + A V + + I K+ Sbjct: 1 MFTDSHCHLTFPEFADQMPQIRAAMAAAKVDRALCICTKLE 41 >gi|188992267|ref|YP_001904277.1| putative deoxyribonuclease [Xanthomonas campestris pv. campestris str. B100] gi|167734027|emb|CAP52233.1| putative deoxyribonuclease [Xanthomonas campestris pv. campestris] Length = 255 Score = 34.9 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH +FD DR VI RA A V++ + AI Sbjct: 3 LIDSHCHLDASEFDADRAAVIARAQAAGVMQQVVPAI 39 >gi|125974585|ref|YP_001038495.1| TatD family hydrolase [Clostridium thermocellum ATCC 27405] gi|125714810|gb|ABN53302.1| hydrolase, TatD family [Clostridium thermocellum ATCC 27405] Length = 255 Score = 34.9 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 25/44 (56%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTL 44 ML ++H H+ FDEDR VI +A+ + V ++ A + +L Sbjct: 1 MLFDSHAHYDNKRFDEDRFEVIKKAYDSGVSYILNAAADMASSL 44 >gi|291326930|ref|ZP_06126391.2| hydrogenase nickel insertion protein HypA [Providencia rettgeri DSM 1131] gi|291312571|gb|EFE53024.1| hydrogenase nickel insertion protein HypA [Providencia rettgeri DSM 1131] Length = 265 Score = 34.9 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F + + A Q+ V +I Sbjct: 10 FIDTHCHFDFPPFSDSFTESLQLAQQSGVSDII 42 >gi|225387108|ref|ZP_03756872.1| hypothetical protein CLOSTASPAR_00858 [Clostridium asparagiforme DSM 15981] gi|225046794|gb|EEG57040.1| hypothetical protein CLOSTASPAR_00858 [Clostridium asparagiforme DSM 15981] Length = 256 Score = 34.9 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M+ +TH H+ DFD DR ++ A V + I Sbjct: 1 MIFDTHAHYDDEDFDGDRQALLEGLSGAGVRAVTNI 36 >gi|73666912|ref|YP_302928.1| TatD-related deoxyribonuclease [Ehrlichia canis str. Jake] gi|72394053|gb|AAZ68330.1| TatD-related deoxyribonuclease [Ehrlichia canis str. Jake] Length = 260 Score = 34.9 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M++++HCH + DE + +++RA + NV M + Sbjct: 1 MIVDSHCHLNYFNPDEIK-GIVLRAEENNVKLMQTVCT 37 >gi|324520478|gb|ADY47647.1| Deoxyribonuclease TATDN3 [Ascaris suum] Length = 264 Score = 34.9 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 +I+ HCH F +D V+ RA +A V + + Sbjct: 1 MIDCHCHLADEQFADDIDEVVDRARRAGVAATLVCS 36 >gi|212637882|ref|YP_002314402.1| Mg-dependent DNAse [Anoxybacillus flavithermus WK1] gi|212559362|gb|ACJ32417.1| Mg-dependent DNAse [Anoxybacillus flavithermus WK1] Length = 255 Score = 34.9 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI RA V ++ + Sbjct: 1 MLFDTHAHLNATQFNEDVGQVIERARAEGVSHIVVV 36 >gi|209695683|ref|YP_002263612.1| putative TatD-related deoxyribonuclease [Aliivibrio salmonicida LFI1238] gi|208009635|emb|CAQ79931.1| putative TatD-related deoxyribonuclease [Aliivibrio salmonicida LFI1238] Length = 256 Score = 34.9 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Query: 1 MLINTHCHFL---LPDFDEDRHNVIMRAHQANVLKMIAIAI 38 MLI++HCH D +VI +A Q V + + + + Sbjct: 1 MLIDSHCHLDKLNYDDLHVSVGDVIEKAKQRGVSQFLTVGV 41 >gi|116073734|ref|ZP_01470996.1| hypothetical protein RS9916_34827 [Synechococcus sp. RS9916] gi|116069039|gb|EAU74791.1| hypothetical protein RS9916_34827 [Synechococcus sp. RS9916] Length = 261 Score = 34.9 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI++HCH + +F++D V R A V+ ++ ++ Sbjct: 6 LIDSHCHIVFRNFEDDLEEVSARWRDAGVVALLHACVE 43 >gi|153840055|ref|ZP_01992722.1| hydrolase, TatD family [Vibrio parahaemolyticus AQ3810] gi|149746366|gb|EDM57411.1| hydrolase, TatD family [Vibrio parahaemolyticus AQ3810] Length = 253 Score = 34.9 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA + K++ Sbjct: 1 MIDTHAHIYASEFDNDRDEVVERALTQGITKIL 33 >gi|327438101|dbj|BAK14466.1| Mg-dependent DNase [Solibacillus silvestris StLB046] Length = 256 Score = 34.5 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 20/35 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 I+TH H +DED VI RA ANV KM+ I Sbjct: 4 FIDTHVHLNADQYDEDLQEVIDRAIAANVEKMVVI 38 >gi|226330523|ref|ZP_03806041.1| hypothetical protein PROPEN_04441 [Proteus penneri ATCC 35198] gi|225201318|gb|EEG83672.1| hypothetical protein PROPEN_04441 [Proteus penneri ATCC 35198] Length = 261 Score = 34.5 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Query: 2 LINTHCHFLLPDFD---EDRHNVIMRAHQANVLKMIAIAI 38 L+++HCH D++ E+ +V+ +A Q +V M+A+A Sbjct: 3 LVDSHCHLDCLDYEKLHENIDDVVEKAQQRDVQYMLAVAT 42 >gi|21230882|ref|NP_636799.1| hypothetical protein XCC1426 [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66769119|ref|YP_243881.1| hypothetical protein XC_2812 [Xanthomonas campestris pv. campestris str. 8004] gi|21112491|gb|AAM40723.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66574451|gb|AAY49861.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. 8004] Length = 255 Score = 34.5 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 23/37 (62%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH +FD DR VI RA A V++ + AI Sbjct: 3 LIDSHCHLDASEFDADRAAVIARAKAAGVMQQVVPAI 39 >gi|50085450|ref|YP_046960.1| putative deoxyribonuclease [Acinetobacter sp. ADP1] gi|49531426|emb|CAG69138.1| conserved hypothetical protein; putative deoxyribonuclease [Acinetobacter sp. ADP1] Length = 257 Score = 34.5 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Query: 1 MLINTHCHF---LLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M ++THCH L + + ++ A +A V K ++I++ + Sbjct: 1 MFVDTHCHLTMLDLTPYQGNLDQALVEAREAGVSKFMSISVNL 43 >gi|291614003|ref|YP_003524160.1| hydrolase, TatD family [Sideroxydans lithotrophicus ES-1] gi|291584115|gb|ADE11773.1| hydrolase, TatD family [Sideroxydans lithotrophicus ES-1] Length = 255 Score = 34.5 bits (78), Expect = 4.3, Method: Composition-based stats. Identities = 9/40 (22%), Positives = 20/40 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M I++HCH P ED ++ +V + +++++ Sbjct: 1 MFIDSHCHLNFPGLVEDLDAILANMRANDVTHALCVSVEL 40 >gi|95930672|ref|ZP_01313406.1| TatD-related deoxyribonuclease [Desulfuromonas acetoxidans DSM 684] gi|95133324|gb|EAT14989.1| TatD-related deoxyribonuclease [Desulfuromonas acetoxidans DSM 684] Length = 460 Score = 34.5 bits (78), Expect = 4.3, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 19/42 (45%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 L++TH H F ED VI RA V +I + + + Sbjct: 6 LVDTHAHLDGNRFAEDLEQVIQRADDQGVHSIITVGCDLESS 47 >gi|293605098|ref|ZP_06687490.1| TatD family deoxyribonuclease [Achromobacter piechaudii ATCC 43553] gi|292816501|gb|EFF75590.1| TatD family deoxyribonuclease [Achromobacter piechaudii ATCC 43553] Length = 256 Score = 34.5 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 8/40 (20%), Positives = 19/40 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M +++HCH P+ D ++ R V + +++ + Sbjct: 1 MYVDSHCHLNFPELAADLPAILERMAANQVSHALVVSVNM 40 >gi|237808930|ref|YP_002893370.1| hydrolase, TatD family [Tolumonas auensis DSM 9187] gi|237501191|gb|ACQ93784.1| hydrolase, TatD family [Tolumonas auensis DSM 9187] Length = 258 Score = 34.5 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQAN 29 ML+++HCH D+D+ H++ H+A Sbjct: 1 MLVDSHCHLDRLDYDKKHHDLADVLHKAG 29 >gi|322515574|ref|ZP_08068555.1| TatD family hydrolase [Actinobacillus ureae ATCC 25976] gi|322118377|gb|EFX90643.1| TatD family hydrolase [Actinobacillus ureae ATCC 25976] Length = 262 Score = 34.5 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAIKVIR 42 +I++HCH D++ VI A V I+I + R Sbjct: 6 IIDSHCHLDALDYETRHKNVDEVIENAKARGVHHFISICTTLGR 49 >gi|269959446|ref|ZP_06173829.1| conserved hypothetical protein [Vibrio harveyi 1DA3] gi|269835883|gb|EEZ89959.1| conserved hypothetical protein [Vibrio harveyi 1DA3] Length = 254 Score = 34.5 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA + + +++ Sbjct: 1 MIDTHAHIYASEFDNDRDEVVKRALEQGIDRIL 33 >gi|229528967|ref|ZP_04418357.1| hypothetical protein VCG_002057 [Vibrio cholerae 12129(1)] gi|229332741|gb|EEN98227.1| hypothetical protein VCG_002057 [Vibrio cholerae 12129(1)] Length = 255 Score = 34.5 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Query: 1 MLINTHCH---FLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M +++HCH D ED +V+ +AHQA V ++++ + Sbjct: 1 MFVDSHCHLDKLDYQDLHEDVSDVLAKAHQAKVEYLLSVGV 41 >gi|256419294|ref|YP_003119947.1| hydrolase, TatD family [Chitinophaga pinensis DSM 2588] gi|256034202|gb|ACU57746.1| hydrolase, TatD family [Chitinophaga pinensis DSM 2588] Length = 256 Score = 34.5 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 I+TH H DF +DR V+ RA A V ++ Sbjct: 4 IDTHAHLYGEDFSDDRTAVVERALAAGVERL 34 >gi|228956481|ref|ZP_04118278.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar pakistani str. T13001] gi|228803171|gb|EEM49992.1| Uncharacterized deoxyribonuclease yabD [Bacillus thuringiensis serovar pakistani str. T13001] Length = 255 Score = 34.5 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 17/36 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ D VI R +A V + + Sbjct: 1 MLFDTHSHLNAEQFEGDLQEVIDRMKEAGVTYTVVV 36 >gi|261855221|ref|YP_003262504.1| hydrolase, TatD family [Halothiobacillus neapolitanus c2] gi|261835690|gb|ACX95457.1| hydrolase, TatD family [Halothiobacillus neapolitanus c2] Length = 269 Score = 34.5 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPD---FDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 L ++HCH D FD+ +M A +A V +M+ +AI R Sbjct: 3 LFDSHCHLDKLDLTPFDDSFDQFMMAAFEAGVRRMLCVAIHPDR 46 >gi|207110441|ref|ZP_03244603.1| hypothetical protein HpylH_15323 [Helicobacter pylori HPKX_438_CA4C1] Length = 65 Score = 34.5 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+THCH D++ D V+ + + V + + Sbjct: 1 MFIDTHCHLDHRDYENDLEEVLKESLEKGVTQCV 34 >gi|153216419|ref|ZP_01950454.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|153827003|ref|ZP_01979670.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|153830250|ref|ZP_01982917.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|229514874|ref|ZP_04404335.1| hypothetical protein VCB_002526 [Vibrio cholerae TMA 21] gi|124114278|gb|EAY33098.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|148874263|gb|EDL72398.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|149739122|gb|EDM53411.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|229348854|gb|EEO13812.1| hypothetical protein VCB_002526 [Vibrio cholerae TMA 21] Length = 255 Score = 34.5 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Query: 1 MLINTHCH---FLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M +++HCH D D +V+ +AHQA V ++++ + Sbjct: 1 MFVDSHCHLDKLDYQDLHADVSDVLAKAHQAKVEYLLSVGV 41 >gi|324528883|gb|ADY48962.1| Deoxyribonuclease TATDN3 [Ascaris suum] Length = 211 Score = 34.5 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 +I+ HCH F +D V+ RA +A V + + Sbjct: 1 MIDCHCHLADEQFADDIDEVVDRARRAGVAATLVCS 36 >gi|56752515|ref|YP_173216.1| Mg-dependent DNase [Synechococcus elongatus PCC 6301] gi|56687474|dbj|BAD80696.1| Mg-dependent DNase [Synechococcus elongatus PCC 6301] Length = 265 Score = 34.5 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 17/37 (45%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L++TH H F + V + QA V +++ + Sbjct: 3 LVDTHVHLNFDCFAAELDAVADQWRQAGVARLVHSCV 39 >gi|297528407|ref|YP_003669682.1| hydrolase, TatD family [Geobacillus sp. C56-T3] gi|297251659|gb|ADI25105.1| hydrolase, TatD family [Geobacillus sp. C56-T3] Length = 256 Score = 34.5 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H ++ED VI RA V ++ + Sbjct: 1 MLFDTHAHLNAVQYEEDLEQVIERARDEGVSHIVVV 36 >gi|255011166|ref|ZP_05283292.1| putative DNAse related protein [Bacteroides fragilis 3_1_12] gi|313148978|ref|ZP_07811171.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12] gi|313137745|gb|EFR55105.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12] Length = 258 Score = 34.5 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 ML+++H H L +F ED V+ RA A V + Sbjct: 1 MLVDSHSHLFLEEFAEDLPLVMERARAAGVTHI 33 >gi|56418567|ref|YP_145885.1| deoxyribonuclease [Geobacillus kaustophilus HTA426] gi|56378409|dbj|BAD74317.1| deoxyribonuclease [Geobacillus kaustophilus HTA426] Length = 256 Score = 34.5 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H ++ED VI RA V ++ + Sbjct: 1 MLFDTHAHLNAVQYEEDLEQVIERARDEGVSHIVVV 36 >gi|46143620|ref|ZP_00134807.2| COG0084: Mg-dependent DNase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|126209274|ref|YP_001054499.1| putative Mg-dependent DNAse [Actinobacillus pleuropneumoniae L20] gi|303250063|ref|ZP_07336265.1| putative deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|307253495|ref|ZP_07535366.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|126098066|gb|ABN74894.1| Putative Mg-dependent DNAse [Actinobacillus pleuropneumoniae serovar 5b str. L20] gi|302651126|gb|EFL81280.1| putative deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306859174|gb|EFM91216.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 6 str. Femo] Length = 262 Score = 34.5 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAIKVIR 42 +I++HCH D++ VI A V I+I + R Sbjct: 6 IIDSHCHLDALDYETRHKNVDQVIENAKARGVHHFISICTTLGR 49 >gi|312882613|ref|ZP_07742352.1| Mg-dependent DNase [Vibrio caribbenthicus ATCC BAA-2122] gi|309369698|gb|EFP97211.1| Mg-dependent DNase [Vibrio caribbenthicus ATCC BAA-2122] Length = 253 Score = 34.5 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD+DR +I RA + + K++ Sbjct: 1 MIDTHAHIYADEFDQDRDQIITRALEQGIDKIL 33 >gi|291521136|emb|CBK79429.1| hydrolase, TatD family [Coprococcus catus GD/7] Length = 258 Score = 34.5 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 23/43 (53%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 M+ TH H+ FDEDR +++ +A + +++ I + T Sbjct: 1 MIFETHAHYDDKMFDEDRESLLESMQEAGIGRIVNIGADLAST 43 >gi|221135076|ref|ZP_03561379.1| TatD-related deoxyribonuclease [Glaciecola sp. HTCC2999] Length = 263 Score = 34.5 bits (78), Expect = 4.7, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I++HCH L FD D VI RA +V + I Sbjct: 1 MIDSHCHLDLACFDNDIEQVIQRALDNDVHQFI 33 >gi|81300330|ref|YP_400538.1| Sec-independent protein translocase TatD [Synechococcus elongatus PCC 7942] gi|81169211|gb|ABB57551.1| Sec-independent protein translocase TatD [Synechococcus elongatus PCC 7942] Length = 265 Score = 34.5 bits (78), Expect = 4.7, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 17/37 (45%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L++TH H F + V + QA V +++ + Sbjct: 3 LVDTHVHLNFDCFAAELDAVADQWRQAGVARLVHSCV 39 >gi|254226911|ref|ZP_04920478.1| conserved hypothetical protein [Vibrio cholerae V51] gi|125620557|gb|EAZ48924.1| conserved hypothetical protein [Vibrio cholerae V51] Length = 255 Score = 34.5 bits (78), Expect = 4.7, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Query: 1 MLINTHCH---FLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M +++HCH D D +V+ +AHQA V ++++ + Sbjct: 1 MFVDSHCHLDKLDYQDLHADVSDVLAKAHQAKVEYLLSVGV 41 >gi|190151166|ref|YP_001969691.1| Mg-dependent DNAse [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|307246740|ref|ZP_07528810.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|307251109|ref|ZP_07533033.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|307255725|ref|ZP_07537529.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|307257910|ref|ZP_07539665.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|307260177|ref|ZP_07541887.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|307262304|ref|ZP_07543953.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|307264515|ref|ZP_07546100.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 13 str. N273] gi|189916297|gb|ACE62549.1| Putative Mg-dependent DNAse [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|306852440|gb|EFM84675.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|306856939|gb|EFM89071.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|306861402|gb|EFM93392.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|306863597|gb|EFM95525.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|306865823|gb|EFM97701.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|306868067|gb|EFM99894.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|306870212|gb|EFN01971.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 13 str. N273] Length = 262 Score = 34.5 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAIKVIR 42 +I++HCH D++ VI A V I+I + R Sbjct: 6 IIDSHCHLDALDYETRHKNVDQVIENAKARGVHHFISICTTLGR 49 >gi|188584686|ref|YP_001916231.1| hydrolase, TatD family [Natranaerobius thermophilus JW/NM-WN-LF] gi|179349373|gb|ACB83643.1| hydrolase, TatD family [Natranaerobius thermophilus JW/NM-WN-LF] Length = 256 Score = 34.5 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 21/39 (53%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 +I+TH H F D +VI RA Q V ++I + I + Sbjct: 3 IIDTHAHLDDKRFSSDLEDVIERAKQKKVSQIINVGINI 41 >gi|153815216|ref|ZP_01967884.1| hypothetical protein RUMTOR_01450 [Ruminococcus torques ATCC 27756] gi|145847475|gb|EDK24393.1| hypothetical protein RUMTOR_01450 [Ruminococcus torques ATCC 27756] Length = 139 Score = 34.5 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 20/34 (58%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M+I+TH H+ FDEDR ++ + A + ++ Sbjct: 1 MIIDTHAHYDDEQFDEDREEILGKMQDAGIGMIM 34 >gi|83858303|ref|ZP_00951825.1| urease/pyrimidinase family protein [Oceanicaulis alexandrii HTCC2633] gi|83853126|gb|EAP90978.1| urease/pyrimidinase family protein [Oceanicaulis alexandrii HTCC2633] Length = 260 Score = 34.5 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 22/40 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+TH + D+ D +V+ A A V MIAI ++ Sbjct: 1 MLIDTHINVHGEDYANDLDSVLDAARDAGVSPMIAICCRL 40 >gi|328471652|gb|EGF42529.1| hypothetical protein VP10329_00815 [Vibrio parahaemolyticus 10329] Length = 253 Score = 34.5 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA + K++ Sbjct: 1 MIDTHAHIYASEFDNDRDEVVERALTQGITKIL 33 >gi|28896876|ref|NP_796481.1| hypothetical protein VP0103 [Vibrio parahaemolyticus RIMD 2210633] gi|260364656|ref|ZP_05777251.1| hydrolase, TatD family [Vibrio parahaemolyticus K5030] gi|260877777|ref|ZP_05890132.1| hydrolase, TatD family [Vibrio parahaemolyticus AN-5034] gi|260895573|ref|ZP_05904069.1| hydrolase, TatD family [Vibrio parahaemolyticus Peru-466] gi|260902598|ref|ZP_05910993.1| hydrolase, TatD family [Vibrio parahaemolyticus AQ4037] gi|28805084|dbj|BAC58365.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] gi|308088603|gb|EFO38298.1| hydrolase, TatD family [Vibrio parahaemolyticus Peru-466] gi|308089894|gb|EFO39589.1| hydrolase, TatD family [Vibrio parahaemolyticus AN-5034] gi|308109603|gb|EFO47143.1| hydrolase, TatD family [Vibrio parahaemolyticus AQ4037] gi|308112634|gb|EFO50174.1| hydrolase, TatD family [Vibrio parahaemolyticus K5030] Length = 253 Score = 34.5 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA + K++ Sbjct: 1 MIDTHAHIYASEFDNDRDEVVERALTQGITKIL 33 >gi|297579518|ref|ZP_06941446.1| conserved hypothetical protein [Vibrio cholerae RC385] gi|297537112|gb|EFH75945.1| conserved hypothetical protein [Vibrio cholerae RC385] Length = 261 Score = 34.5 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Query: 1 MLINTHCH---FLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M +++HCH D D +V+ +AHQA V ++++ + Sbjct: 1 MFVDSHCHLDKLDYQDLHADVSDVLAKAHQAKVEYLLSVGV 41 >gi|165977247|ref|YP_001652840.1| putative deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|303253237|ref|ZP_07339386.1| putative deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|307248882|ref|ZP_07530894.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|165877348|gb|ABY70396.1| putative deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|302647919|gb|EFL78126.1| putative deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|306854619|gb|EFM86810.1| Deoxyribonuclease [Actinobacillus pleuropneumoniae serovar 2 str. S1536] Length = 262 Score = 34.5 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAIKVIR 42 +I++HCH D++ VI A V I+I + R Sbjct: 6 IIDSHCHLDALDYETRHKNVDQVIENAKARGVHHFISICTTLGR 49 >gi|53723789|ref|YP_103314.1| TatD family hydrolase [Burkholderia mallei ATCC 23344] gi|67642986|ref|ZP_00441736.1| hydrolase, TatD family [Burkholderia mallei GB8 horse 4] gi|121598195|ref|YP_993511.1| TatD family hydrolase [Burkholderia mallei SAVP1] gi|124383573|ref|YP_001029060.1| TatD family hydrolase [Burkholderia mallei NCTC 10229] gi|126450794|ref|YP_001081019.1| putative deoxyribonuclease yjjV [Burkholderia mallei NCTC 10247] gi|126452641|ref|YP_001066890.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 1106a] gi|134277516|ref|ZP_01764231.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 305] gi|167000668|ref|ZP_02266479.1| hydrolase, TatD family [Burkholderia mallei PRL-20] gi|167824938|ref|ZP_02456409.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 9] gi|167846455|ref|ZP_02471963.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei B7210] gi|226195499|ref|ZP_03791087.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei Pakistan 9] gi|242317786|ref|ZP_04816802.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 1106b] gi|254177993|ref|ZP_04884648.1| hydrolase, TatD family [Burkholderia mallei ATCC 10399] gi|254184380|ref|ZP_04890970.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 1655] gi|254200269|ref|ZP_04906635.1| putative deoxyribonuclease yjjV [Burkholderia mallei FMH] gi|254209347|ref|ZP_04915693.1| putative deoxyribonuclease yjjV [Burkholderia mallei JHU] gi|254357982|ref|ZP_04974255.1| putative deoxyribonuclease yjjV [Burkholderia mallei 2002721280] gi|52427212|gb|AAU47805.1| hydrolase, TatD family [Burkholderia mallei ATCC 23344] gi|121227005|gb|ABM49523.1| hydrolase, TatD family [Burkholderia mallei SAVP1] gi|124291593|gb|ABN00862.1| hydrolase, TatD family [Burkholderia mallei NCTC 10229] gi|126226283|gb|ABN89823.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 1106a] gi|126243664|gb|ABO06757.1| hydrolase, TatD family [Burkholderia mallei NCTC 10247] gi|134251166|gb|EBA51245.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 305] gi|147749865|gb|EDK56939.1| putative deoxyribonuclease yjjV [Burkholderia mallei FMH] gi|147750120|gb|EDK57191.1| putative deoxyribonuclease yjjV [Burkholderia mallei JHU] gi|148027109|gb|EDK85130.1| putative deoxyribonuclease yjjV [Burkholderia mallei 2002721280] gi|160699032|gb|EDP89002.1| hydrolase, TatD family [Burkholderia mallei ATCC 10399] gi|184214911|gb|EDU11954.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 1655] gi|225932459|gb|EEH28458.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei Pakistan 9] gi|238524219|gb|EEP87653.1| hydrolase, TatD family [Burkholderia mallei GB8 horse 4] gi|242141025|gb|EES27427.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 1106b] gi|243063475|gb|EES45661.1| hydrolase, TatD family [Burkholderia mallei PRL-20] Length = 262 Score = 34.5 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 1 MLINTHCHFLLPDFDEDRH 19 M I+THCH P+FD DR Sbjct: 1 MWIDTHCHLDAPEFDADRE 19 >gi|319903087|ref|YP_004162815.1| hydrolase, TatD family [Bacteroides helcogenes P 36-108] gi|319418118|gb|ADV45229.1| hydrolase, TatD family [Bacteroides helcogenes P 36-108] Length = 259 Score = 34.5 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKM 33 LI++H H L +F ED V+ RA +A V + Sbjct: 3 LIDSHSHLFLEEFAEDLPQVMERAKEAGVTHI 34 >gi|257899758|ref|ZP_05679411.1| hydrolase [Enterococcus faecium Com15] gi|257837670|gb|EEV62744.1| hydrolase [Enterococcus faecium Com15] Length = 258 Score = 34.5 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M+ ++H H F+ED I RA + V KM + Sbjct: 1 MIFDSHTHLNAEQFNEDIPETIQRAQEMGVTKMAVV 36 >gi|227552437|ref|ZP_03982486.1| TatD family deoxyribonuclease [Enterococcus faecium TX1330] gi|257888323|ref|ZP_05667976.1| hydrolase [Enterococcus faecium 1,141,733] gi|257896787|ref|ZP_05676440.1| hydrolase [Enterococcus faecium Com12] gi|293378581|ref|ZP_06624744.1| hydrolase, TatD family [Enterococcus faecium PC4.1] gi|227178449|gb|EEI59421.1| TatD family deoxyribonuclease [Enterococcus faecium TX1330] gi|257824377|gb|EEV51309.1| hydrolase [Enterococcus faecium 1,141,733] gi|257833352|gb|EEV59773.1| hydrolase [Enterococcus faecium Com12] gi|292642910|gb|EFF61057.1| hydrolase, TatD family [Enterococcus faecium PC4.1] Length = 258 Score = 34.5 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M+ ++H H F+ED I RA + V KM + Sbjct: 1 MIFDSHTHLNAEQFNEDIPETIQRAQEMGVTKMAVV 36 >gi|39939091|ref|NP_950857.1| Mg-dependent DNase [Onion yellows phytoplasma OY-M] gi|39722200|dbj|BAD04690.1| Mg-dependent DNase [Onion yellows phytoplasma OY-M] Length = 255 Score = 34.5 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H L + +V +A +V KMI I Sbjct: 1 MLIDTHAHLNLKTYKNKLDDVFQKAWNNDVKKMIVI 36 >gi|320539930|ref|ZP_08039589.1| putative DNase [Serratia symbiotica str. Tucson] gi|320030116|gb|EFW12136.1| putative DNase [Serratia symbiotica str. Tucson] Length = 260 Score = 34.5 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 18/39 (46%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 +THCHF P F + A + V K+I A+ R Sbjct: 7 DTHCHFDFPPFSGHEVESLALAERVGVRKIIVPAVTADR 45 >gi|261417532|ref|YP_003251214.1| hydrolase, TatD family [Geobacillus sp. Y412MC61] gi|319765189|ref|YP_004130690.1| hydrolase, TatD family [Geobacillus sp. Y412MC52] gi|261373989|gb|ACX76732.1| hydrolase, TatD family [Geobacillus sp. Y412MC61] gi|317110055|gb|ADU92547.1| hydrolase, TatD family [Geobacillus sp. Y412MC52] Length = 256 Score = 34.5 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H ++ED VI RA V ++ + Sbjct: 1 MLFDTHAHLNAVQYEEDLEQVIERARDEGVSHIVVV 36 >gi|260549043|ref|ZP_05823264.1| hydrolase [Acinetobacter sp. RUH2624] gi|260407771|gb|EEX01243.1| hydrolase [Acinetobacter sp. RUH2624] Length = 270 Score = 34.5 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH HF + DF+EDR + + A + V ++ I Sbjct: 3 LFDTHTHFDVADFNEDRLQLALEAKKVGVDALVLI 37 >gi|167720334|ref|ZP_02403570.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei DM98] Length = 262 Score = 34.5 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 1 MLINTHCHFLLPDFDEDRH 19 M I+THCH P+FD DR Sbjct: 1 MWIDTHCHLDAPEFDADRE 19 >gi|299820689|ref|ZP_07052578.1| TatD family deoxyribonuclease [Listeria grayi DSM 20601] gi|299817710|gb|EFI84945.1| TatD family deoxyribonuclease [Listeria grayi DSM 20601] Length = 257 Score = 34.5 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED I RA + +V KM + Sbjct: 1 MLFDTHVHLNDEAFNEDLEETIARARENDVTKMAVV 36 >gi|86153267|ref|ZP_01071471.1| putative deoxyribonuclease [Campylobacter jejuni subsp. jejuni HB93-13] gi|121612578|ref|YP_001000345.1| TatD family hydrolase [Campylobacter jejuni subsp. jejuni 81-176] gi|167005290|ref|ZP_02271048.1| hydrolase, TatD family protein [Campylobacter jejuni subsp. jejuni 81-176] gi|85842993|gb|EAQ60204.1| putative deoxyribonuclease [Campylobacter jejuni subsp. jejuni HB93-13] gi|87250185|gb|EAQ73143.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni 81-176] Length = 271 Score = 34.5 bits (78), Expect = 5.3, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++THCH F +D + RA + + K+I Sbjct: 13 IVDTHCHLDSEAFKDDLDETLNRAFKNGIEKII 45 >gi|229528655|ref|ZP_04418045.1| hypothetical protein VCG_001741 [Vibrio cholerae 12129(1)] gi|229332429|gb|EEN97915.1| hypothetical protein VCG_001741 [Vibrio cholerae 12129(1)] Length = 282 Score = 34.5 bits (78), Expect = 5.3, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 L +THCHF P F + +A Q V +++ +I Sbjct: 22 LFDTHCHFDFPPFTASELEL-QKAAQHGVRRLVVPSI 57 >gi|293573154|ref|ZP_06684091.1| putative deoxyribonuclease YcfH [Enterococcus faecium E980] gi|291606792|gb|EFF36177.1| putative deoxyribonuclease YcfH [Enterococcus faecium E980] Length = 258 Score = 34.2 bits (77), Expect = 5.4, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M+ ++H H F+ED I RA + V KM + Sbjct: 1 MIFDSHTHLNAEQFNEDIPETIQRAQEMGVTKMAVV 36 >gi|254994885|ref|ZP_05277075.1| hypothetical protein AmarM_02010 [Anaplasma marginale str. Mississippi] gi|255003018|ref|ZP_05277982.1| hypothetical protein AmarPR_01790 [Anaplasma marginale str. Puerto Rico] Length = 262 Score = 34.2 bits (77), Expect = 5.4, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M++++HCH D D +V+ +A A V M + Sbjct: 1 MIVDSHCHLNHFD-DSAIQDVVKQATDAGVALMQTVCT 37 >gi|162452051|ref|YP_001614418.1| TatD family deoxyribonuclease [Sorangium cellulosum 'So ce 56'] gi|161162633|emb|CAN93938.1| putative deoxyribonuclease, TatD family [Sorangium cellulosum 'So ce 56'] Length = 264 Score = 34.2 bits (77), Expect = 5.4, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 19/38 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M+I++HCH F E V+ RA A V + + + Sbjct: 1 MIIDSHCHVDPRHFREGADAVLDRARAAGVDAFVVVGV 38 >gi|53719885|ref|YP_108871.1| putative TatD related DNase [Burkholderia pseudomallei K96243] gi|76811742|ref|YP_334102.1| TatD family hydrolase [Burkholderia pseudomallei 1710b] gi|126440474|ref|YP_001059608.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 668] gi|167739327|ref|ZP_02412101.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 14] gi|167816542|ref|ZP_02448222.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 91] gi|167895033|ref|ZP_02482435.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 7894] gi|167903418|ref|ZP_02490623.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei NCTC 13177] gi|167911668|ref|ZP_02498759.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 112] gi|167919669|ref|ZP_02506760.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei BCC215] gi|217421098|ref|ZP_03452603.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 576] gi|254191414|ref|ZP_04897918.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei Pasteur 52237] gi|254195852|ref|ZP_04902278.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei S13] gi|254261272|ref|ZP_04952326.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 1710a] gi|254297045|ref|ZP_04964498.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 406e] gi|52210299|emb|CAH36278.1| putative TatD related DNase [Burkholderia pseudomallei K96243] gi|76581195|gb|ABA50670.1| hydrolase, TatD family [Burkholderia pseudomallei 1710b] gi|126219967|gb|ABN83473.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 668] gi|157807109|gb|EDO84279.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 406e] gi|157939086|gb|EDO94756.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei Pasteur 52237] gi|169652597|gb|EDS85290.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei S13] gi|217396510|gb|EEC36527.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 576] gi|254219961|gb|EET09345.1| putative deoxyribonuclease yjjV [Burkholderia pseudomallei 1710a] Length = 262 Score = 34.2 bits (77), Expect = 5.4, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 1 MLINTHCHFLLPDFDEDRH 19 M I+THCH P+FD DR Sbjct: 1 MWIDTHCHLDAPEFDADRE 19 >gi|88596844|ref|ZP_01100080.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni 84-25] gi|218562294|ref|YP_002344073.1| putative TatD-related deoxyribonuclease protein [Campylobacter jejuni subsp. jejuni NCTC 11168] gi|88190533|gb|EAQ94506.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni 84-25] gi|112360000|emb|CAL34789.1| putative TatD-related deoxyribonuclease protein [Campylobacter jejuni subsp. jejuni NCTC 11168] gi|284925904|gb|ADC28256.1| TatD family hydrolase [Campylobacter jejuni subsp. jejuni IA3902] gi|315926762|gb|EFV06136.1| hydrolase, TatD family protein [Campylobacter jejuni subsp. jejuni DFVF1099] Length = 271 Score = 34.2 bits (77), Expect = 5.4, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++THCH F +D + RA + + K+I Sbjct: 13 IVDTHCHLDSEAFKDDLDETLNRAFKNGIEKII 45 >gi|257880092|ref|ZP_05659745.1| hydrolase [Enterococcus faecium 1,230,933] gi|257882324|ref|ZP_05661977.1| hydrolase [Enterococcus faecium 1,231,502] gi|257885521|ref|ZP_05665174.1| hydrolase [Enterococcus faecium 1,231,501] gi|257891183|ref|ZP_05670836.1| hydrolase [Enterococcus faecium 1,231,410] gi|257893996|ref|ZP_05673649.1| hydrolase [Enterococcus faecium 1,231,408] gi|258614575|ref|ZP_05712345.1| TatD family hydrolase [Enterococcus faecium DO] gi|260560299|ref|ZP_05832475.1| hydrolase [Enterococcus faecium C68] gi|261208236|ref|ZP_05922909.1| hydrolase [Enterococcus faecium TC 6] gi|289565963|ref|ZP_06446402.1| hydrolase [Enterococcus faecium D344SRF] gi|293557285|ref|ZP_06675832.1| fused fructose-specific PTS enzymes: IIA component/HPr component [Enterococcus faecium E1039] gi|293563097|ref|ZP_06677563.1| putative deoxyribonuclease YcfH [Enterococcus faecium E1162] gi|293567523|ref|ZP_06678868.1| putative deoxyribonuclease YcfH [Enterococcus faecium E1071] gi|294615975|ref|ZP_06695802.1| putative deoxyribonuclease YcfH [Enterococcus faecium E1636] gi|294617636|ref|ZP_06697264.1| putative deoxyribonuclease YcfH [Enterococcus faecium E1679] gi|294623377|ref|ZP_06702236.1| putative deoxyribonuclease YcfH [Enterococcus faecium U0317] gi|314940233|ref|ZP_07847406.1| hydrolase, TatD family [Enterococcus faecium TX0133a04] gi|314941708|ref|ZP_07848587.1| hydrolase, TatD family [Enterococcus faecium TX0133C] gi|314947648|ref|ZP_07851057.1| hydrolase, TatD family [Enterococcus faecium TX0082] gi|314950634|ref|ZP_07853714.1| hydrolase, TatD family [Enterococcus faecium TX0133A] gi|314992499|ref|ZP_07857920.1| hydrolase, TatD family [Enterococcus faecium TX0133B] gi|314996347|ref|ZP_07861400.1| hydrolase, TatD family [Enterococcus faecium TX0133a01] gi|257814320|gb|EEV43078.1| hydrolase [Enterococcus faecium 1,230,933] gi|257817982|gb|EEV45310.1| hydrolase [Enterococcus faecium 1,231,502] gi|257821377|gb|EEV48507.1| hydrolase [Enterococcus faecium 1,231,501] gi|257827543|gb|EEV54169.1| hydrolase [Enterococcus faecium 1,231,410] gi|257830375|gb|EEV56982.1| hydrolase [Enterococcus faecium 1,231,408] gi|260073644|gb|EEW61970.1| hydrolase [Enterococcus faecium C68] gi|260077493|gb|EEW65211.1| hydrolase [Enterococcus faecium TC 6] gi|289162247|gb|EFD10108.1| hydrolase [Enterococcus faecium D344SRF] gi|291589766|gb|EFF21569.1| putative deoxyribonuclease YcfH [Enterococcus faecium E1071] gi|291591161|gb|EFF22843.1| putative deoxyribonuclease YcfH [Enterococcus faecium E1636] gi|291596100|gb|EFF27365.1| putative deoxyribonuclease YcfH [Enterococcus faecium E1679] gi|291597224|gb|EFF28416.1| putative deoxyribonuclease YcfH [Enterococcus faecium U0317] gi|291600572|gb|EFF30877.1| fused fructose-specific PTS enzymes: IIA component/HPr component [Enterococcus faecium E1039] gi|291605011|gb|EFF34479.1| putative deoxyribonuclease YcfH [Enterococcus faecium E1162] gi|313589490|gb|EFR68335.1| hydrolase, TatD family [Enterococcus faecium TX0133a01] gi|313592959|gb|EFR71804.1| hydrolase, TatD family [Enterococcus faecium TX0133B] gi|313597181|gb|EFR76026.1| hydrolase, TatD family [Enterococcus faecium TX0133A] gi|313599480|gb|EFR78323.1| hydrolase, TatD family [Enterococcus faecium TX0133C] gi|313640553|gb|EFS05133.1| hydrolase, TatD family [Enterococcus faecium TX0133a04] gi|313645889|gb|EFS10469.1| hydrolase, TatD family [Enterococcus faecium TX0082] Length = 258 Score = 34.2 bits (77), Expect = 5.4, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M+ ++H H F+ED I RA + V KM + Sbjct: 1 MIFDSHTHLNAEQFNEDIPETIQRAQEMGVTKMAVV 36 >gi|37521936|ref|NP_925313.1| deoxyribonuclease [Gloeobacter violaceus PCC 7421] gi|35212935|dbj|BAC90308.1| gll2367 [Gloeobacter violaceus PCC 7421] Length = 263 Score = 34.2 bits (77), Expect = 5.5, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 18/38 (47%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 L++TH H +F D V A V++++ +K Sbjct: 7 LVDTHVHINYENFAADLDAVAHNWRAAGVVQLVHACVK 44 >gi|302877768|ref|YP_003846332.1| TatD-related deoxyribonuclease [Gallionella capsiferriformans ES-2] gi|302580557|gb|ADL54568.1| TatD-related deoxyribonuclease [Gallionella capsiferriformans ES-2] Length = 266 Score = 34.2 bits (77), Expect = 5.7, Method: Composition-based stats. Identities = 8/37 (21%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI+THCH +F + +++ A + ++ ++ Sbjct: 12 LIDTHCHLDAAEFAGHQAELLLAAQSTGISHIVVPSV 48 >gi|85057420|ref|YP_456336.1| Mg-dependent DNase [Aster yellows witches'-broom phytoplasma AYWB] gi|84789525|gb|ABC65257.1| Mg-dependent DNase [Aster yellows witches'-broom phytoplasma AYWB] Length = 255 Score = 34.2 bits (77), Expect = 5.7, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 MLI+TH H L + +V +A +V KMI I Sbjct: 1 MLIDTHTHLNLKTYKNKLDDVFQKAWNNDVKKMIVI 36 >gi|157414923|ref|YP_001482179.1| TatD family hydrolase [Campylobacter jejuni subsp. jejuni 81116] gi|157385887|gb|ABV52202.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni 81116] gi|307747561|gb|ADN90831.1| Hydrolase, TatD family [Campylobacter jejuni subsp. jejuni M1] gi|315931842|gb|EFV10797.1| hydrolase, TatD family protein [Campylobacter jejuni subsp. jejuni 327] Length = 271 Score = 34.2 bits (77), Expect = 5.7, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++THCH F +D + RA + + K+I Sbjct: 13 IVDTHCHLDSEAFKDDLDETLNRAFKNGIEKII 45 >gi|74316506|ref|YP_314246.1| putative TatD related DNase [Thiobacillus denitrificans ATCC 25259] gi|74056001|gb|AAZ96441.1| putative TatD related DNase [Thiobacillus denitrificans ATCC 25259] Length = 256 Score = 34.2 bits (77), Expect = 5.7, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 12/21 (57%) Query: 4 NTHCHFLLPDFDEDRHNVIMR 24 +THCH +FD DR + R Sbjct: 6 DTHCHLDAAEFDADRDAIHAR 26 >gi|261819884|ref|YP_003257990.1| TatD-related deoxyribonuclease [Pectobacterium wasabiae WPP163] gi|261603897|gb|ACX86383.1| TatD-related deoxyribonuclease [Pectobacterium wasabiae WPP163] Length = 265 Score = 34.2 bits (77), Expect = 5.8, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F +D + A A V ++I Sbjct: 8 FIDTHCHFDFPLFYDDAPESLRLARDAGVERII 40 >gi|170727885|ref|YP_001761911.1| TatD-like deoxyribonuclease [Shewanella woodyi ATCC 51908] gi|169813232|gb|ACA87816.1| TatD-related deoxyribonuclease [Shewanella woodyi ATCC 51908] Length = 263 Score = 34.2 bits (77), Expect = 5.8, Method: Composition-based stats. Identities = 8/29 (27%), Positives = 15/29 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANV 30 +I++H H P+FD+DR + + Sbjct: 10 IIDSHAHIDFPEFDDDRAELFKAMRAMGI 38 >gi|262372468|ref|ZP_06065747.1| Mg-dependent DNase [Acinetobacter junii SH205] gi|262312493|gb|EEY93578.1| Mg-dependent DNase [Acinetobacter junii SH205] Length = 257 Score = 34.2 bits (77), Expect = 5.9, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Query: 1 MLINTHCH---FLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M ++THCH L + D + A QA V K + I++ + Sbjct: 1 MFVDTHCHLTMLDLTPYGGDLDQALDAARQAGVTKFMGISVDLE 44 >gi|260775062|ref|ZP_05883961.1| deoxyribonuclease TatD [Vibrio coralliilyticus ATCC BAA-450] gi|260608979|gb|EEX35139.1| deoxyribonuclease TatD [Vibrio coralliilyticus ATCC BAA-450] Length = 284 Score = 34.2 bits (77), Expect = 5.9, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA + K++ Sbjct: 32 MIDTHAHIYASEFDNDRDQVVERALAQGIDKIL 64 >gi|241668073|ref|ZP_04755651.1| TatD family hydrolase [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254876608|ref|ZP_05249318.1| magnesium-dependent DNase [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254842629|gb|EET21043.1| magnesium-dependent DNase [Francisella philomiragia subsp. philomiragia ATCC 25015] Length = 255 Score = 34.2 bits (77), Expect = 5.9, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Query: 1 MLINTHCHFLLPDFDE-DRHNVIMRAHQANVLKMIAIAI 38 M+I++HCH D+ VI A +A + K+++IA+ Sbjct: 1 MIIDSHCHLNYLKLDDISLEKVIDNAKEAGIEKIVSIAV 39 >gi|294496910|ref|YP_003560610.1| deoxyribonuclease, TatD family [Bacillus megaterium QM B1551] gi|294346847|gb|ADE67176.1| deoxyribonuclease, TatD family [Bacillus megaterium QM B1551] Length = 256 Score = 34.2 bits (77), Expect = 5.9, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H +++D VI RA + V M+ + Sbjct: 1 MLFDTHVHLNAEQYEDDLQEVINRALEKGVQNMVVV 36 >gi|57236957|ref|YP_178758.1| TatD family hydrolase [Campylobacter jejuni RM1221] gi|86149857|ref|ZP_01068086.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni CF93-6] gi|86151597|ref|ZP_01069811.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni 260.94] gi|205355494|ref|ZP_03222265.1| hypothetical protein Cj8421_0646 [Campylobacter jejuni subsp. jejuni CG8421] gi|315124159|ref|YP_004066163.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni ICDCCJ07001] gi|57165761|gb|AAW34540.1| hydrolase, TatD family [Campylobacter jejuni RM1221] gi|85839675|gb|EAQ56935.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni CF93-6] gi|85841226|gb|EAQ58474.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni 260.94] gi|205346728|gb|EDZ33360.1| hypothetical protein Cj8421_0646 [Campylobacter jejuni subsp. jejuni CG8421] gi|315017881|gb|ADT65974.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni ICDCCJ07001] gi|315058058|gb|ADT72387.1| Putative deoxyribonuclease YcfH [Campylobacter jejuni subsp. jejuni S3] Length = 271 Score = 34.2 bits (77), Expect = 5.9, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++THCH F +D + RA + + K+I Sbjct: 13 IVDTHCHLDSEAFKDDLDETLNRAFKNGIEKII 45 >gi|197284753|ref|YP_002150625.1| deoxyribonuclease [Proteus mirabilis HI4320] gi|227357758|ref|ZP_03842107.1| magnesium (Mg2+)-dependent deoxyribonuclease [Proteus mirabilis ATCC 29906] gi|194682240|emb|CAR41963.1| putative deoxyribonuclease [Proteus mirabilis HI4320] gi|227162087|gb|EEI47101.1| magnesium (Mg2+)-dependent deoxyribonuclease [Proteus mirabilis ATCC 29906] Length = 261 Score = 34.2 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Query: 2 LINTHCHFLLPDFD---EDRHNVIMRAHQANVLKMIAIAI 38 L+++HCH D++ ++ +V+ +A Q +V M+A+A Sbjct: 3 LVDSHCHLDSLDYEKLHKNIDDVVEKAQQRDVKYMLAVAT 42 >gi|117925164|ref|YP_865781.1| TatD family hydrolase [Magnetococcus sp. MC-1] gi|117608920|gb|ABK44375.1| hydrolase, TatD family [Magnetococcus sp. MC-1] Length = 459 Score = 34.2 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 19/39 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 L ++H H F ED +V+ RA Q V + I ++ Sbjct: 3 LADSHAHLNFDAFKEDLPSVLQRARQQGVRYLNMIGTRL 41 >gi|295702277|ref|YP_003595352.1| TatD family deoxyribonuclease [Bacillus megaterium DSM 319] gi|294799936|gb|ADF37002.1| deoxyribonuclease, TatD family [Bacillus megaterium DSM 319] Length = 256 Score = 34.2 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H +++D VI RA + V M+ + Sbjct: 1 MLFDTHVHLNAEQYEDDLQEVINRALEKGVQNMVVV 36 >gi|293373957|ref|ZP_06620299.1| hydrolase, TatD family [Bacteroides ovatus SD CMC 3f] gi|292631178|gb|EFF49814.1| hydrolase, TatD family [Bacteroides ovatus SD CMC 3f] Length = 258 Score = 34.2 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANV 30 MLI+TH H + +F ED V+ RA +A V Sbjct: 1 MLIDTHSHLFVEEFTEDLPLVMERAQKAGV 30 >gi|283956058|ref|ZP_06373545.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni 1336] gi|283792378|gb|EFC31160.1| hydrolase, TatD family [Campylobacter jejuni subsp. jejuni 1336] Length = 271 Score = 34.2 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++THCH F +D + RA + + K+I Sbjct: 13 IVDTHCHLDSEAFKDDLDETLNRAFKNGIEKII 45 >gi|254448304|ref|ZP_05061766.1| deoxyribonuclease, TatD family [gamma proteobacterium HTCC5015] gi|198262171|gb|EDY86454.1| deoxyribonuclease, TatD family [gamma proteobacterium HTCC5015] Length = 255 Score = 34.2 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 16/40 (40%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 +++HCHF F D + R A V ++ R Sbjct: 1 MDSHCHFDFDVFSHDFDAELARCRAAGVSTIVVPGTTSAR 40 >gi|34558357|ref|NP_908172.1| putative Mg dependent DNase [Wolinella succinogenes DSM 1740] gi|34484076|emb|CAE11072.1| conserved hypothetical protein-PUTATIVE Mg DEPENDENT DNase [Wolinella succinogenes] Length = 258 Score = 34.2 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+THCH + ED VI RA V + + Sbjct: 1 MIDTHCHLDDASYKEDIAEVIERALSLGVERFV 33 >gi|254228531|ref|ZP_04921956.1| hydrolase, TatD family [Vibrio sp. Ex25] gi|262392694|ref|YP_003284548.1| deoxyribonuclease TatD [Vibrio sp. Ex25] gi|151938913|gb|EDN57746.1| hydrolase, TatD family [Vibrio sp. Ex25] gi|262336288|gb|ACY50083.1| deoxyribonuclease TatD [Vibrio sp. Ex25] Length = 253 Score = 34.2 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA + K++ Sbjct: 1 MIDTHAHIYASEFDNDRDEVVQRALAQGINKIL 33 >gi|160882689|ref|ZP_02063692.1| hypothetical protein BACOVA_00646 [Bacteroides ovatus ATCC 8483] gi|156111859|gb|EDO13604.1| hypothetical protein BACOVA_00646 [Bacteroides ovatus ATCC 8483] Length = 258 Score = 34.2 bits (77), Expect = 6.1, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANV 30 MLI+TH H + +F ED V+ RA +A V Sbjct: 1 MLIDTHSHLFVEEFTEDLPLVMERAQKAGV 30 >gi|254507849|ref|ZP_05119979.1| metalloenzyme [Vibrio parahaemolyticus 16] gi|219549222|gb|EED26217.1| metalloenzyme [Vibrio parahaemolyticus 16] Length = 257 Score = 34.2 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCHF F ++ + + +A+Q V + + Sbjct: 3 LFDTHCHFDFEPFADNFSDNLAQANQCGVERFV 35 >gi|299147997|ref|ZP_07041060.1| hydrolase, TatD family [Bacteroides sp. 3_1_23] gi|298514180|gb|EFI38066.1| hydrolase, TatD family [Bacteroides sp. 3_1_23] Length = 258 Score = 34.2 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANV 30 MLI+TH H + +F ED V+ RA +A V Sbjct: 1 MLIDTHSHLFVEEFTEDLPLVMERAQKAGV 30 >gi|27262182|gb|AAN87372.1| Sec-independent protein TatD [Heliobacillus mobilis] Length = 258 Score = 34.2 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH H F +DR V +A +A V ++ + Sbjct: 3 LFDTHAHMDDKSFRDDREEVFAQAREAGVELIVNV 37 >gi|330817647|ref|YP_004361352.1| TatD-related deoxyribonuclease [Burkholderia gladioli BSR3] gi|327370040|gb|AEA61396.1| TatD-related deoxyribonuclease [Burkholderia gladioli BSR3] Length = 261 Score = 34.2 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 21/38 (55%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M I+THCH +FD DR V+ A A V ++ +I Sbjct: 1 MWIDTHCHLDAGEFDADREAVVDAAADAGVSGIVIPSI 38 >gi|237720119|ref|ZP_04550600.1| conserved hypothetical protein [Bacteroides sp. 2_2_4] gi|229450671|gb|EEO56462.1| conserved hypothetical protein [Bacteroides sp. 2_2_4] Length = 258 Score = 34.2 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANV 30 MLI+TH H + +F ED V+ RA +A V Sbjct: 1 MLIDTHSHLFVEEFTEDLPLVMERAQKAGV 30 >gi|52078534|ref|YP_077325.1| putative TatD-related deoxyribonuclease YabD [Bacillus licheniformis ATCC 14580] gi|52783896|ref|YP_089725.1| YabD [Bacillus licheniformis ATCC 14580] gi|319648563|ref|ZP_08002777.1| YabD protein [Bacillus sp. BT1B_CT2] gi|52001745|gb|AAU21687.1| putative TatD-related deoxyribonuclease YabD [Bacillus licheniformis ATCC 14580] gi|52346398|gb|AAU39032.1| YabD [Bacillus licheniformis ATCC 14580] gi|317389330|gb|EFV70143.1| YabD protein [Bacillus sp. BT1B_CT2] Length = 255 Score = 34.2 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 19/36 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H F+ED VI RA + V ++ + Sbjct: 1 MLFDTHAHLNAEQFNEDLEEVIARAKEEKVEHIVVV 36 >gi|213964032|ref|ZP_03392275.1| hydrolase, TatD family [Capnocytophaga sputigena Capno] gi|213953314|gb|EEB64653.1| hydrolase, TatD family [Capnocytophaga sputigena Capno] Length = 253 Score = 34.2 bits (77), Expect = 6.5, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 +I+TH H +FD DR +I RA A V + Sbjct: 1 MIDTHTHLYSEEFDTDRVEMIARAKAAGVTR 31 >gi|138893710|ref|YP_001124163.1| TatD family deoxyribonuclease [Geobacillus thermodenitrificans NG80-2] gi|196250753|ref|ZP_03149440.1| hydrolase, TatD family [Geobacillus sp. G11MC16] gi|134265223|gb|ABO65418.1| Deoxyribonuclease TatD family [Geobacillus thermodenitrificans NG80-2] gi|196209703|gb|EDY04475.1| hydrolase, TatD family [Geobacillus sp. G11MC16] Length = 256 Score = 34.2 bits (77), Expect = 6.5, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H ++ED VI RA V ++ + Sbjct: 1 MLFDTHAHLNAVQYEEDLEQVIERARAEGVSYIVVV 36 >gi|299137615|ref|ZP_07030796.1| hydrolase, TatD family [Acidobacterium sp. MP5ACTX8] gi|298600256|gb|EFI56413.1| hydrolase, TatD family [Acidobacterium sp. MP5ACTX8] Length = 277 Score = 34.2 bits (77), Expect = 6.6, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 LI++HCH D+D + V+ A +A V K++AI I Sbjct: 3 LIDSHCHLD--DYD-NLPQVLANAREAGVAKLLAIGI 36 >gi|282881609|ref|ZP_06290278.1| hydrolase, TatD family [Prevotella timonensis CRIS 5C-B1] gi|281304595|gb|EFA96686.1| hydrolase, TatD family [Prevotella timonensis CRIS 5C-B1] Length = 277 Score = 34.2 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 ++TH H +F +D VI RA A V K+ AI Sbjct: 9 FVDTHAHLDGEEFKDDLPEVIARAQTAGVGKIFVPAI 45 >gi|254361185|ref|ZP_04977329.1| deoxyribonuclease [Mannheimia haemolytica PHL213] gi|153092676|gb|EDN73725.1| deoxyribonuclease [Mannheimia haemolytica PHL213] Length = 206 Score = 34.2 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAIKVIR 42 +I++HCH D++ VI A V I++ V R Sbjct: 6 IIDSHCHLDSLDYETRHKNVDEVIENAKARGVHHFISVCTTVGR 49 >gi|296313475|ref|ZP_06863416.1| hydrolase, TatD family [Neisseria polysaccharea ATCC 43768] gi|296839994|gb|EFH23932.1| hydrolase, TatD family [Neisseria polysaccharea ATCC 43768] Length = 259 Score = 34.2 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 20/38 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 L +THCH P E+ +V+ A +A V + I A + Sbjct: 3 LTDTHCHLADPALRENLTHVLTAAREAGVGRFIVPATR 40 >gi|171058564|ref|YP_001790913.1| TatD family hydrolase [Leptothrix cholodnii SP-6] gi|170776009|gb|ACB34148.1| hydrolase, TatD family [Leptothrix cholodnii SP-6] Length = 258 Score = 34.2 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 17/41 (41%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH P+ + + A V + + I + Sbjct: 1 MFVDSHCHLSFPELSARLGEIRAQMQAAQVDRALCICTTLE 41 >gi|256004053|ref|ZP_05429038.1| hydrolase, TatD family [Clostridium thermocellum DSM 2360] gi|281419110|ref|ZP_06250127.1| hydrolase, TatD family [Clostridium thermocellum JW20] gi|255991976|gb|EEU02073.1| hydrolase, TatD family [Clostridium thermocellum DSM 2360] gi|281407259|gb|EFB37520.1| hydrolase, TatD family [Clostridium thermocellum JW20] gi|316941703|gb|ADU75737.1| hydrolase, TatD family [Clostridium thermocellum DSM 1313] Length = 255 Score = 34.2 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 22/37 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 ML ++H H+ FDEDR VI +A+ + V ++ A Sbjct: 1 MLFDSHAHYDNKRFDEDRFEVIKKAYDSGVSYILNAA 37 >gi|322379282|ref|ZP_08053668.1| DNAse [Helicobacter suis HS1] gi|322379846|ref|ZP_08054134.1| DNAse [Helicobacter suis HS5] gi|321147724|gb|EFX42336.1| DNAse [Helicobacter suis HS5] gi|321148319|gb|EFX42833.1| DNAse [Helicobacter suis HS1] Length = 258 Score = 34.2 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L++THCH P + D V+ A + V I Sbjct: 5 LVDTHCHLDHPSYQADFLKVLQNAQEVGVQTAI 37 >gi|146310202|ref|YP_001175276.1| TatD-related deoxyribonuclease [Enterobacter sp. 638] gi|145317078|gb|ABP59225.1| TatD-related deoxyribonuclease [Enterobacter sp. 638] Length = 260 Score = 34.2 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 19/38 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 ++THCHF P F I +A A V +I AI+ Sbjct: 5 FVDTHCHFDFPPFTGHEAQSIQQAADAGVQAIIVPAIE 42 >gi|108809841|ref|YP_653757.1| putative metalloenzyme [Yersinia pestis Antiqua] gi|108810470|ref|YP_646237.1| metalloenzyme [Yersinia pestis Nepal516] gi|145600454|ref|YP_001164530.1| metalloenzyme [Yersinia pestis Pestoides F] gi|162419471|ref|YP_001605408.1| TatD family hydrolase [Yersinia pestis Angola] gi|165927340|ref|ZP_02223172.1| hydrolase, TatD family [Yersinia pestis biovar Orientalis str. F1991016] gi|165936582|ref|ZP_02225150.1| hydrolase, TatD family [Yersinia pestis biovar Orientalis str. IP275] gi|166008819|ref|ZP_02229717.1| hydrolase, TatD family [Yersinia pestis biovar Antiqua str. E1979001] gi|166211923|ref|ZP_02237958.1| hydrolase, TatD family [Yersinia pestis biovar Antiqua str. B42003004] gi|167400670|ref|ZP_02306179.1| hydrolase, TatD family [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167419256|ref|ZP_02311009.1| hydrolase, TatD family [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167426114|ref|ZP_02317867.1| hydrolase, TatD family [Yersinia pestis biovar Mediaevalis str. K1973002] gi|167469149|ref|ZP_02333853.1| putative metalloenzyme [Yersinia pestis FV-1] gi|170025844|ref|YP_001722349.1| TatD-related deoxyribonuclease [Yersinia pseudotuberculosis YPIII] gi|270487982|ref|ZP_06205056.1| hydrolase, TatD family [Yersinia pestis KIM D27] gi|294502531|ref|YP_003566593.1| metalloenzyme [Yersinia pestis Z176003] gi|108774118|gb|ABG16637.1| metalloenzyme [Yersinia pestis Nepal516] gi|108781754|gb|ABG15812.1| putative metalloenzyme [Yersinia pestis Antiqua] gi|145212150|gb|ABP41557.1| metalloenzyme [Yersinia pestis Pestoides F] gi|162352286|gb|ABX86234.1| hydrolase, TatD family [Yersinia pestis Angola] gi|165915698|gb|EDR34307.1| hydrolase, TatD family [Yersinia pestis biovar Orientalis str. IP275] gi|165920802|gb|EDR38050.1| hydrolase, TatD family [Yersinia pestis biovar Orientalis str. F1991016] gi|165992158|gb|EDR44459.1| hydrolase, TatD family [Yersinia pestis biovar Antiqua str. E1979001] gi|166206669|gb|EDR51149.1| hydrolase, TatD family [Yersinia pestis biovar Antiqua str. B42003004] gi|166963250|gb|EDR59271.1| hydrolase, TatD family [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167050038|gb|EDR61446.1| hydrolase, TatD family [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167055037|gb|EDR64837.1| hydrolase, TatD family [Yersinia pestis biovar Mediaevalis str. K1973002] gi|169752378|gb|ACA69896.1| TatD-related deoxyribonuclease [Yersinia pseudotuberculosis YPIII] gi|262360561|gb|ACY57282.1| metalloenzyme [Yersinia pestis D106004] gi|262364507|gb|ACY61064.1| metalloenzyme [Yersinia pestis D182038] gi|270336486|gb|EFA47263.1| hydrolase, TatD family [Yersinia pestis KIM D27] gi|294352990|gb|ADE63331.1| metalloenzyme [Yersinia pestis Z176003] Length = 269 Score = 34.2 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + A +ANV ++I ++K Sbjct: 11 FIDTHCHFDFPPFTGDEAASLACAAEANVRQLIVPSVK 48 >gi|51246631|ref|YP_066515.1| hypothetical protein DP2779 [Desulfotalea psychrophila LSv54] gi|50877668|emb|CAG37508.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54] Length = 270 Score = 34.2 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 2 LINTHCHFLLPDFDEDR-HNVIMRAHQANVLKMIAIAIKVIRTL 44 +I+THCH + + ED V+ A Q V K+I I + ++ Sbjct: 15 VIDTHCHLDMDAYQEDGFAQVLANALQNGVSKIITIGTNLESSI 58 >gi|112491012|pdb|2GZX|A Chain A, Crystal Structure Of The Tatd Deoxyribonuclease Mw0446 From Staphylococcus Aureus. Northeast Structural Genomics Consortium Target Zr237. gi|112491013|pdb|2GZX|B Chain B, Crystal Structure Of The Tatd Deoxyribonuclease Mw0446 From Staphylococcus Aureus. Northeast Structural Genomics Consortium Target Zr237 Length = 265 Score = 33.8 bits (76), Expect = 7.0, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 19/35 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 LI+TH H +D+D VI RA +A V + + Sbjct: 2 LIDTHVHLNDEQYDDDLSEVITRAREAGVDRXFVV 36 >gi|51594930|ref|YP_069121.1| hydrolase [Yersinia pseudotuberculosis IP 32953] gi|153949108|ref|YP_001402455.1| TatD family hydrolase [Yersinia pseudotuberculosis IP 31758] gi|51588212|emb|CAH19819.1| putative hydrolase [Yersinia pseudotuberculosis IP 32953] gi|152960603|gb|ABS48064.1| hydrolase, TatD family [Yersinia pseudotuberculosis IP 31758] Length = 262 Score = 33.8 bits (76), Expect = 7.1, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + A +ANV ++I ++K Sbjct: 4 FIDTHCHFDFPPFTGDEAASLACAAEANVRQLIVPSVK 41 >gi|226325807|ref|ZP_03801325.1| hypothetical protein COPCOM_03620 [Coprococcus comes ATCC 27758] gi|225205931|gb|EEG88285.1| hypothetical protein COPCOM_03620 [Coprococcus comes ATCC 27758] Length = 253 Score = 33.8 bits (76), Expect = 7.2, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 18/37 (48%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 M+ +TH H+ FD DR ++ V ++ ++ Sbjct: 1 MIFDTHAHYDDEQFDGDRDELLKSMPDLGVGTIVDVS 37 >gi|186893930|ref|YP_001871042.1| TatD-related deoxyribonuclease [Yersinia pseudotuberculosis PB1/+] gi|186696956|gb|ACC87585.1| TatD-related deoxyribonuclease [Yersinia pseudotuberculosis PB1/+] Length = 269 Score = 33.8 bits (76), Expect = 7.2, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + A +ANV ++I ++K Sbjct: 11 FIDTHCHFDFPPFTGDEAASLACAAEANVRQLIVPSVK 48 >gi|30249487|ref|NP_841557.1| hypothetical protein NE1516 [Nitrosomonas europaea ATCC 19718] gi|30138850|emb|CAD85427.1| Uncharacterized protein family UPF0006 [Nitrosomonas europaea ATCC 19718] Length = 254 Score = 33.8 bits (76), Expect = 7.2, Method: Composition-based stats. Identities = 7/41 (17%), Positives = 18/41 (43%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH PD +++ + V + + + + Sbjct: 1 MFVDSHCHLDFPDLASSLDELLVNMQISQVTHALCVGVNLE 41 >gi|22127616|ref|NP_671039.1| hypothetical protein y3745 [Yersinia pestis KIM 10] gi|45443479|ref|NP_995018.1| putative metalloenzyme [Yersinia pestis biovar Microtus str. 91001] gi|21960727|gb|AAM87290.1|AE013978_2 hypothetical protein y3745 [Yersinia pestis KIM 10] gi|45438348|gb|AAS63895.1| putative metalloenzyme [Yersinia pestis biovar Microtus str. 91001] Length = 270 Score = 33.8 bits (76), Expect = 7.2, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + A +ANV ++I ++K Sbjct: 12 FIDTHCHFDFPPFTGDEAASLACAAEANVRQLIVPSVK 49 >gi|34581337|ref|ZP_00142817.1| hypothetical protein [Rickettsia sibirica 246] gi|28262722|gb|EAA26226.1| unknown [Rickettsia sibirica 246] Length = 306 Score = 33.8 bits (76), Expect = 7.2, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 22/56 (39%), Gaps = 15/56 (26%) Query: 1 MLINTHCHFLLPDFDEDR---------------HNVIMRAHQANVLKMIAIAIKVI 41 MLI++HCH L R +VI RA + NV M I K+ Sbjct: 1 MLIDSHCHLNLCSNLSSRDVDTVVKPWYDAVLLDSVIQRALENNVQYMQTICTKIE 56 >gi|150260526|ref|ZP_01917254.1| putative metalloenzyme [Yersinia pestis CA88-4125] gi|218927635|ref|YP_002345510.1| putative metalloenzyme [Yersinia pestis CO92] gi|229836985|ref|ZP_04457150.1| predicted DNase [Yersinia pestis Pestoides A] gi|229840317|ref|ZP_04460476.1| predicted DNase [Yersinia pestis biovar Orientalis str. PEXU2] gi|229842396|ref|ZP_04462551.1| predicted DNase [Yersinia pestis biovar Orientalis str. India 195] gi|229900658|ref|ZP_04515782.1| predicted DNase [Yersinia pestis Nepal516] gi|115346246|emb|CAL19115.1| putative metalloenzyme [Yersinia pestis CO92] gi|149289934|gb|EDM40011.1| putative metalloenzyme [Yersinia pestis CA88-4125] gi|229681997|gb|EEO78089.1| predicted DNase [Yersinia pestis Nepal516] gi|229690706|gb|EEO82760.1| predicted DNase [Yersinia pestis biovar Orientalis str. India 195] gi|229696683|gb|EEO86730.1| predicted DNase [Yersinia pestis biovar Orientalis str. PEXU2] gi|229705928|gb|EEO91937.1| predicted DNase [Yersinia pestis Pestoides A] Length = 262 Score = 33.8 bits (76), Expect = 7.2, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 22/38 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 I+THCHF P F D + A +ANV ++I ++K Sbjct: 4 FIDTHCHFDFPPFTGDEAASLACAAEANVRQLIVPSVK 41 >gi|282877392|ref|ZP_06286215.1| hydrolase, TatD family [Prevotella buccalis ATCC 35310] gi|281300444|gb|EFA92790.1| hydrolase, TatD family [Prevotella buccalis ATCC 35310] Length = 274 Score = 33.8 bits (76), Expect = 7.3, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 19/37 (51%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 I+TH H +F +D VI RA A V K+ AI Sbjct: 5 FIDTHAHLDGEEFQDDLPEVIARAKAAGVEKIFVPAI 41 >gi|261365200|ref|ZP_05978083.1| hydrolase, TatD family [Neisseria mucosa ATCC 25996] gi|288566461|gb|EFC88021.1| hydrolase, TatD family [Neisseria mucosa ATCC 25996] Length = 263 Score = 33.8 bits (76), Expect = 7.3, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 20/38 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 L +THCH P E+ +V+ A +A V + I A + Sbjct: 3 LTDTHCHLADPALRENLPHVLTAAREAGVGRFIVPATR 40 >gi|149191869|ref|ZP_01870104.1| putative deoxyribonuclease [Vibrio shilonii AK1] gi|148834304|gb|EDL51306.1| putative deoxyribonuclease [Vibrio shilonii AK1] Length = 255 Score = 33.8 bits (76), Expect = 7.3, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Query: 1 MLINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAI 38 M +++HCH D+D+ +VI +A ANV K++++ + Sbjct: 1 MFVDSHCHLDKLDYDDVHLGIQDVIQKAKAANVEKLLSVGV 41 >gi|119944854|ref|YP_942534.1| deoxyribonuclease of TatD family protein [Psychromonas ingrahamii 37] gi|119863458|gb|ABM02935.1| deoxyribonuclease of TatD family protein [Psychromonas ingrahamii 37] Length = 258 Score = 33.8 bits (76), Expect = 7.5, Method: Composition-based stats. Identities = 9/44 (20%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Query: 1 MLINTHCHFLLPDFD---EDRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH D+ +D +V+ +A + + ++++ + + Sbjct: 1 MLVDSHCHLDRLDYKNKHKDLSDVVNKAKEQGIDHLLSVCVTLK 44 >gi|229587040|ref|YP_002845541.1| Putative deoxyribonuclease TatD [Rickettsia africae ESF-5] gi|228022090|gb|ACP53798.1| Putative deoxyribonuclease TatD [Rickettsia africae ESF-5] Length = 306 Score = 33.8 bits (76), Expect = 7.6, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 22/56 (39%), Gaps = 15/56 (26%) Query: 1 MLINTHCHFLLPDFDEDR---------------HNVIMRAHQANVLKMIAIAIKVI 41 MLI++HCH L R +VI RA + NV M I K+ Sbjct: 1 MLIDSHCHLNLRSNLSSRDVDTVVKPWYDAVLLDSVIQRALENNVQYMQTICTKIE 56 >gi|153951957|ref|YP_001398398.1| TatD family hydrolase [Campylobacter jejuni subsp. doylei 269.97] gi|152939403|gb|ABS44144.1| hydrolase, TatD family [Campylobacter jejuni subsp. doylei 269.97] Length = 271 Score = 33.8 bits (76), Expect = 7.7, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +++THCH F +D + RA + + K+I Sbjct: 13 IVDTHCHLDSEAFKDDLDETLNRAFKNGIDKII 45 >gi|150026320|ref|YP_001297146.1| TatD-related DNase [Flavobacterium psychrophilum JIP02/86] gi|149772861|emb|CAL44345.1| TatD-related DNase [Flavobacterium psychrophilum JIP02/86] Length = 256 Score = 33.8 bits (76), Expect = 7.8, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 20/42 (47%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 LI+TH H +FD DR +I A V ++ +I T Sbjct: 3 LIDTHTHLYANEFDSDRDEMIKNAISRGVSRLFIPSIDASYT 44 >gi|328551740|gb|AEB22232.1| metal-dependent DNase [Bacillus amyloliquefaciens TA208] gi|328910000|gb|AEB61596.1| metal-dependent DNase [Bacillus amyloliquefaciens LL3] Length = 255 Score = 33.8 bits (76), Expect = 8.0, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H FD D VI RA V +++ + Sbjct: 1 MLFDTHAHLNAEQFDTDLEEVIARAKAEKVERIVVV 36 >gi|291547423|emb|CBL20531.1| hydrolase, TatD family [Ruminococcus sp. SR1/5] Length = 402 Score = 33.8 bits (76), Expect = 8.0, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M+ +TH H+ FDEDR +++ + + ++ + V Sbjct: 145 MIFDTHAHYDDEAFDEDRSDMLDGMQENGIGHIVDVCASV 184 >gi|154684558|ref|YP_001419719.1| YabD [Bacillus amyloliquefaciens FZB42] gi|154350409|gb|ABS72488.1| YabD [Bacillus amyloliquefaciens FZB42] Length = 256 Score = 33.8 bits (76), Expect = 8.0, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H FD D VI RA V +++ + Sbjct: 2 MLFDTHAHLNAEQFDTDLEEVIARAKAEEVERIVVV 37 >gi|52424626|ref|YP_087763.1| TatD protein [Mannheimia succiniciproducens MBEL55E] gi|52306678|gb|AAU37178.1| TatD protein [Mannheimia succiniciproducens MBEL55E] Length = 260 Score = 33.8 bits (76), Expect = 8.0, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFD---EDRHNVIMRAHQANVLKMIAIAIKVIR 42 ++++HCH D++ + VI +A V +++I + + R Sbjct: 3 IVDSHCHLDSLDYEKLHSNVDEVIEKAKARGVKHLLSIGVALNR 46 >gi|326316635|ref|YP_004234307.1| hydrolase, TatD family [Acidovorax avenae subsp. avenae ATCC 19860] gi|323373471|gb|ADX45740.1| hydrolase, TatD family [Acidovorax avenae subsp. avenae ATCC 19860] Length = 269 Score = 33.8 bits (76), Expect = 8.1, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 16/41 (39%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M ++HCH P+ + +A V + + I + Sbjct: 1 MFTDSHCHLSFPELSAQLPAIRQAMDEARVTRALCICTTME 41 >gi|91224940|ref|ZP_01260199.1| hypothetical protein V12G01_10978 [Vibrio alginolyticus 12G01] gi|269964576|ref|ZP_06178815.1| conserved hypothetical protein [Vibrio alginolyticus 40B] gi|91190186|gb|EAS76456.1| hypothetical protein V12G01_10978 [Vibrio alginolyticus 12G01] gi|269830703|gb|EEZ84923.1| conserved hypothetical protein [Vibrio alginolyticus 40B] Length = 253 Score = 33.8 bits (76), Expect = 8.1, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I+TH H +FD DR V+ RA + K++ Sbjct: 1 MIDTHAHIYASEFDNDRDEVVQRALTQGINKIL 33 >gi|308171930|ref|YP_003918635.1| metal-dependent DNase [Bacillus amyloliquefaciens DSM 7] gi|307604794|emb|CBI41165.1| metal-dependent DNase [Bacillus amyloliquefaciens DSM 7] Length = 256 Score = 33.8 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H FD D VI RA V +++ + Sbjct: 2 MLFDTHAHLNAEQFDTDLEEVIARAKAEKVERIVVV 37 >gi|56416674|ref|YP_153748.1| hypothetical protein AM447 [Anaplasma marginale str. St. Maries] gi|56387906|gb|AAV86493.1| hypothetical protein AM447 [Anaplasma marginale str. St. Maries] Length = 262 Score = 33.8 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M++++HCH D D +V+ +A A V M + Sbjct: 1 MIVDSHCHLNHFD-DSVIQDVVKQATDAGVALMQTVCT 37 >gi|328675922|gb|AEB28597.1| Putative deoxyribonuclease YjjV [Francisella cf. novicida 3523] Length = 248 Score = 33.8 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 19/39 (48%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 M I+THCH FD+ R ++ + +V I A + Sbjct: 1 MFIDTHCHLDFDIFDKTRQRILHNCNYLSVNYFINPATQ 39 >gi|86140772|ref|ZP_01059331.1| hypothetical protein MED217_16510 [Leeuwenhoekiella blandensis MED217] gi|85832714|gb|EAQ51163.1| hypothetical protein MED217_16510 [Leeuwenhoekiella blandensis MED217] Length = 256 Score = 33.8 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 M I+TH H F EDR +I RA ++ + I Sbjct: 1 MFIDTHTHLYSDSFKEDRDAIIERAINQSINQFI 34 >gi|150387963|ref|YP_001318012.1| TatD family hydrolase [Alkaliphilus metalliredigens QYMF] gi|149947825|gb|ABR46353.1| hydrolase, TatD family [Alkaliphilus metalliredigens QYMF] Length = 255 Score = 33.8 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 ML ++H H FD+DRH +I A V ++ Sbjct: 1 MLFDSHAHIDGGRFDQDRHQMIENAKTNGVSYIL 34 >gi|120612062|ref|YP_971740.1| TatD family hydrolase [Acidovorax citrulli AAC00-1] gi|120590526|gb|ABM33966.1| hydrolase, TatD family [Acidovorax citrulli AAC00-1] Length = 264 Score = 33.8 bits (76), Expect = 8.3, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 16/41 (39%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M ++HCH P+ + +A V + + I + Sbjct: 1 MFTDSHCHLSFPELSAQLPAIRQAMDEARVTRALCICTTME 41 >gi|253686859|ref|YP_003016049.1| TatD-related deoxyribonuclease [Pectobacterium carotovorum subsp. carotovorum PC1] gi|251753437|gb|ACT11513.1| TatD-related deoxyribonuclease [Pectobacterium carotovorum subsp. carotovorum PC1] Length = 265 Score = 33.8 bits (76), Expect = 8.4, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F +D + A A V ++I Sbjct: 8 FIDTHCHFDFPLFYDDAPESLRLAQDAGVERII 40 >gi|91788379|ref|YP_549331.1| TatD-like protein deoxyribonuclease [Polaromonas sp. JS666] gi|91697604|gb|ABE44433.1| TatD-related deoxyribonuclease [Polaromonas sp. JS666] Length = 265 Score = 33.8 bits (76), Expect = 8.4, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 15/41 (36%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M ++HCH P+ + A V + + I + Sbjct: 1 MFTDSHCHLSFPELQAQLPQIRQAMRDAQVDRALCICTTLE 41 >gi|300723623|ref|YP_003712928.1| putative metallo-dependent hydrolase [Xenorhabdus nematophila ATCC 19061] gi|297630145|emb|CBJ90782.1| putative metallo-dependent hydrolase (with domain) [Xenorhabdus nematophila ATCC 19061] Length = 261 Score = 33.8 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Query: 2 LINTHCHFLLPDFD---EDRHNVIMRAHQANVLKMIAIAI 38 L+++HCH D++ + +V+ +A + +V M+A+A Sbjct: 3 LVDSHCHLDCLDYETLHKSVDDVVAKAAERDVKYMLAVAT 42 >gi|150399633|ref|YP_001323400.1| TatD family hydrolase [Methanococcus vannielii SB] gi|150012336|gb|ABR54788.1| hydrolase, TatD family [Methanococcus vannielii SB] Length = 253 Score = 33.8 bits (76), Expect = 8.6, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 19/35 (54%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIA 35 + I++HCH F+++R VI RA V + + Sbjct: 7 LYIDSHCHIEDKSFNKNRDEVIKRAFDGKVGIVTS 41 >gi|50119423|ref|YP_048590.1| TatD family deoxyribonuclease [Pectobacterium atrosepticum SCRI1043] gi|49609949|emb|CAG73387.1| putative TatD-family deoxyribonuclease [Pectobacterium atrosepticum SCRI1043] Length = 265 Score = 33.8 bits (76), Expect = 8.7, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F +D + A A V ++I Sbjct: 8 FIDTHCHFDFPLFYDDAPESLRLAQDAGVERII 40 >gi|262276040|ref|ZP_06053849.1| putative deoxyribonuclease YcfH [Grimontia hollisae CIP 101886] gi|262219848|gb|EEY71164.1| putative deoxyribonuclease YcfH [Grimontia hollisae CIP 101886] Length = 257 Score = 33.8 bits (76), Expect = 8.7, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Query: 1 MLINTHCHFL---LPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 ML+++HCH D D VI A Q V ++++ + + Sbjct: 1 MLVDSHCHLDKLNYKDLHTDVGAVIENARQRGVDYLLSVGVTLK 44 >gi|148266423|ref|YP_001233129.1| TatD family hydrolase [Geobacter uraniireducens Rf4] gi|146399923|gb|ABQ28556.1| hydrolase, TatD family [Geobacter uraniireducens Rf4] Length = 253 Score = 33.8 bits (76), Expect = 8.7, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 15/34 (44%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 MLI+THCH P VI A V K I Sbjct: 1 MLIDTHCHLAAPSLASRLPEVIDAGKMAGVEKFI 34 >gi|313884492|ref|ZP_07818253.1| hydrolase, TatD family [Eremococcus coleocola ACS-139-V-Col8] gi|312620276|gb|EFR31704.1| hydrolase, TatD family [Eremococcus coleocola ACS-139-V-Col8] Length = 262 Score = 33.8 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 14/35 (40%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 L +TH H F+ V+ RA V M + Sbjct: 6 LFDTHTHLNADQFEGIEDQVVQRARDNGVAYMAVV 40 >gi|291482410|dbj|BAI83485.1| hypothetical protein BSNT_00073 [Bacillus subtilis subsp. natto BEST195] Length = 255 Score = 33.8 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 ML +TH H +D D VI RA V +++ + Sbjct: 1 MLFDTHAHLNAEQYDTDLDEVIERAKAEKVERIVVV 36 >gi|257865531|ref|ZP_05645184.1| hydrolase [Enterococcus casseliflavus EC30] gi|257871868|ref|ZP_05651521.1| hydrolase [Enterococcus casseliflavus EC10] gi|257875147|ref|ZP_05654800.1| hydrolase [Enterococcus casseliflavus EC20] gi|257799465|gb|EEV28517.1| hydrolase [Enterococcus casseliflavus EC30] gi|257806032|gb|EEV34854.1| hydrolase [Enterococcus casseliflavus EC10] gi|257809313|gb|EEV38133.1| hydrolase [Enterococcus casseliflavus EC20] Length = 256 Score = 33.8 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 10/36 (27%), Positives = 18/36 (50%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAI 36 M+ ++H H F+ED + RA + V +M + Sbjct: 1 MIFDSHTHLNAEQFNEDIPETVARAQELGVTEMAVV 36 >gi|254410815|ref|ZP_05024593.1| hydrolase, TatD family [Microcoleus chthonoplastes PCC 7420] gi|196182170|gb|EDX77156.1| hydrolase, TatD family [Microcoleus chthonoplastes PCC 7420] Length = 267 Score = 33.8 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 19/38 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI+TH H F+ DR V R V++++ ++ Sbjct: 5 LIDTHVHINFDVFESDREAVRDRWRDVGVVRLVHSCVE 42 >gi|88802152|ref|ZP_01117680.1| Sec-independent protein translocase protein TatD [Polaribacter irgensii 23-P] gi|88782810|gb|EAR13987.1| Sec-independent protein translocase protein TatD [Polaribacter irgensii 23-P] Length = 254 Score = 33.8 bits (76), Expect = 8.9, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLK 32 M+ +TH H +F+ED+ +I RA A V + Sbjct: 1 MITDTHTHLYSTEFNEDQKEMIQRAKDAGVSR 32 >gi|308186416|ref|YP_003930547.1| deoxyribonuclease [Pantoea vagans C9-1] gi|308056926|gb|ADO09098.1| putative deoxyribonuclease [Pantoea vagans C9-1] Length = 263 Score = 33.8 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Query: 2 LINTHCHFLLPDFDE---DRHNVIMRAHQANVLKMIAIAI 38 ++++HCH D+++ D +VI +A +V M+AIA Sbjct: 3 IVDSHCHLDGLDYEKNHRDLDDVIAKAAARDVKFMLAIAT 42 >gi|227326509|ref|ZP_03830533.1| TatD family deoxyribonuclease [Pectobacterium carotovorum subsp. carotovorum WPP14] Length = 265 Score = 33.8 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F +D + A A V ++I Sbjct: 8 FIDTHCHFDFPLFYDDAPESLRLAQDAGVDRII 40 >gi|119511558|ref|ZP_01630666.1| TatD-related deoxyribonuclease [Nodularia spumigena CCY9414] gi|119463793|gb|EAW44722.1| TatD-related deoxyribonuclease [Nodularia spumigena CCY9414] Length = 261 Score = 33.8 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 20/38 (52%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 LI+TH H F+ D V R +A V++++ ++ Sbjct: 3 LIDTHVHLNFDTFEPDLAAVRSRWQEAGVVRLVHSCVE 40 >gi|304396798|ref|ZP_07378678.1| TatD-related deoxyribonuclease [Pantoea sp. aB] gi|304355594|gb|EFM19961.1| TatD-related deoxyribonuclease [Pantoea sp. aB] Length = 265 Score = 33.8 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 23/41 (56%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIR 42 I+THCHF P F+ D + RA +A V K+I AI R Sbjct: 3 FIDTHCHFDFPPFEGDIAASLARAAEAGVEKIIIPAIDASR 43 >gi|58617030|ref|YP_196229.1| hypothetical protein ERGA_CDS_03030 [Ehrlichia ruminantium str. Gardel] gi|58416642|emb|CAI27755.1| Conserved hypothetical protein (putative deoxyribonuclease) [Ehrlichia ruminantium str. Gardel] Length = 261 Score = 33.8 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL 46 M++++HCH + + + +I A V M + + + L Sbjct: 1 MIVDSHCHLNYFNVE-ELPVIISNAEANGVKLMQTVCTTLSESTSL 45 >gi|57239031|ref|YP_180167.1| putative deoxyribonuclease [Ehrlichia ruminantium str. Welgevonden] gi|58578972|ref|YP_197184.1| hypothetical protein ERWE_CDS_03080 [Ehrlichia ruminantium str. Welgevonden] gi|57161110|emb|CAH58020.1| putative deoxyribonuclease [Ehrlichia ruminantium str. Welgevonden] gi|58417598|emb|CAI26802.1| Conserved hypothetical protein (putative deoxyribonuclease) [Ehrlichia ruminantium str. Welgevonden] Length = 261 Score = 33.8 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL 46 M++++HCH + + + +I A V M + + + L Sbjct: 1 MIVDSHCHLNYFNVE-ELPVIISNAEANGVKLMQTVCTTLSESTSL 45 >gi|149911596|ref|ZP_01900208.1| putative deoxyribonuclease [Moritella sp. PE36] gi|149805317|gb|EDM65330.1| putative deoxyribonuclease [Moritella sp. PE36] Length = 257 Score = 33.4 bits (75), Expect = 9.2, Method: Composition-based stats. Identities = 11/45 (24%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Query: 1 MLINTHCHFLLPDFD---EDRHNVIMRAHQANVLKMIAIAIKVIR 42 ML+++HCH ++D D +V+ +A + V ++++++ + R Sbjct: 1 MLVDSHCHLDGLNYDTIHTDLADVVNKAAERGVSHLLSVSVTLPR 45 >gi|325264296|ref|ZP_08131027.1| hydrolase, TatD family [Clostridium sp. D5] gi|324030367|gb|EGB91651.1| hydrolase, TatD family [Clostridium sp. D5] Length = 254 Score = 33.4 bits (75), Expect = 9.3, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 19/40 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M+ +TH H+ F+EDR ++ + V ++ V Sbjct: 1 MIFDTHAHYDDEQFNEDRDALLCSMQEGGVGTIVNAGSDV 40 >gi|227114652|ref|ZP_03828308.1| TatD family deoxyribonuclease [Pectobacterium carotovorum subsp. brasiliensis PBR1692] Length = 265 Score = 33.4 bits (75), Expect = 9.5, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 I+THCHF P F +D + A A V ++I Sbjct: 8 FIDTHCHFDFPLFYDDAPESLRLAQDAGVERII 40 >gi|33152914|ref|NP_874267.1| putative deoxyribonuclease [Haemophilus ducreyi 35000HP] gi|33149139|gb|AAP96656.1| putative deoxyribonuclease [Haemophilus ducreyi 35000HP] Length = 262 Score = 33.4 bits (75), Expect = 9.5, Method: Composition-based stats. Identities = 11/44 (25%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Query: 2 LINTHCHFLLPDFDEDR---HNVIMRAHQANVLKMIAIAIKVIR 42 +I++HCH D+ VI A V I++ + R Sbjct: 6 IIDSHCHLDALDYQTHHKSVDEVIENAKARGVGHFISVCTTLGR 49 >gi|225571220|ref|ZP_03780218.1| hypothetical protein CLOHYLEM_07309 [Clostridium hylemonae DSM 15053] gi|225160051|gb|EEG72670.1| hypothetical protein CLOHYLEM_07309 [Clostridium hylemonae DSM 15053] Length = 259 Score = 33.4 bits (75), Expect = 9.6, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 M+ +TH H+ FDEDR ++ V ++ I+ Sbjct: 1 MIFDTHAHYDDDQFDEDREELLGSMQAGGVGTIVNIS 37 >gi|121604852|ref|YP_982181.1| TatD family hydrolase [Polaromonas naphthalenivorans CJ2] gi|120593821|gb|ABM37260.1| hydrolase, TatD family [Polaromonas naphthalenivorans CJ2] Length = 265 Score = 33.4 bits (75), Expect = 9.6, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 17/41 (41%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M ++HCH P+ E+ + A V + + I + Sbjct: 1 MFTDSHCHLSFPELKENLPEIRQAMQTAQVGRALCICTTLE 41 >gi|313888668|ref|ZP_07822333.1| hydrolase, TatD family [Peptoniphilus harei ACS-146-V-Sch2b] gi|312845397|gb|EFR32793.1| hydrolase, TatD family [Peptoniphilus harei ACS-146-V-Sch2b] Length = 254 Score = 33.4 bits (75), Expect = 9.7, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 +I++H H P FDEDR ++I + +I Sbjct: 1 MIDSHVHLDDPAFDEDRDSLIKSLGDNGIELVI 33 >gi|297616268|ref|YP_003701427.1| hydrolase, TatD family [Syntrophothermus lipocalidus DSM 12680] gi|297144105|gb|ADI00862.1| hydrolase, TatD family [Syntrophothermus lipocalidus DSM 12680] Length = 255 Score = 33.4 bits (75), Expect = 9.7, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 21/43 (48%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 MLI++H H + +DR VI RA + ++ + + + Sbjct: 1 MLIDSHAHLQDKAYRKDREEVIERAFSGGLAGIVCVGYDIESS 43 >gi|15642016|ref|NP_231648.1| hypothetical protein VC2014 [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121590847|ref|ZP_01678172.1| conserved hypothetical protein [Vibrio cholerae 2740-80] gi|121728863|ref|ZP_01681873.1| conserved hypothetical protein [Vibrio cholerae V52] gi|147674791|ref|YP_001217541.1| hypothetical protein VC0395_A1600 [Vibrio cholerae O395] gi|153802879|ref|ZP_01957465.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|153819697|ref|ZP_01972364.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] gi|153822941|ref|ZP_01975608.1| conserved hypothetical protein [Vibrio cholerae B33] gi|227082141|ref|YP_002810692.1| Putative deoxyribonuclease [Vibrio cholerae M66-2] gi|229507897|ref|ZP_04397402.1| hypothetical protein VCF_003126 [Vibrio cholerae BX 330286] gi|229511868|ref|ZP_04401347.1| hypothetical protein VCE_003278 [Vibrio cholerae B33] gi|229519004|ref|ZP_04408447.1| hypothetical protein VCC_003032 [Vibrio cholerae RC9] gi|229607442|ref|YP_002878090.1| hypothetical protein VCD_002353 [Vibrio cholerae MJ-1236] gi|254849101|ref|ZP_05238451.1| conserved hypothetical protein [Vibrio cholerae MO10] gi|255745237|ref|ZP_05419186.1| putative deoxyribonuclease YcfH [Vibrio cholera CIRS 101] gi|262148993|ref|ZP_06028139.1| putative deoxyribonuclease YcfH [Vibrio cholerae INDRE 91/1] gi|262167961|ref|ZP_06035661.1| putative deoxyribonuclease YcfH [Vibrio cholerae RC27] gi|298497956|ref|ZP_07007763.1| conserved hypothetical protein [Vibrio cholerae MAK 757] gi|9656558|gb|AAF95162.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121547298|gb|EAX57418.1| conserved hypothetical protein [Vibrio cholerae 2740-80] gi|121628871|gb|EAX61329.1| conserved hypothetical protein [Vibrio cholerae V52] gi|124121597|gb|EAY40340.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|126509763|gb|EAZ72357.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] gi|126519552|gb|EAZ76775.1| conserved hypothetical protein [Vibrio cholerae B33] gi|146316674|gb|ABQ21213.1| conserved hypothetical protein [Vibrio cholerae O395] gi|227010029|gb|ACP06241.1| Putative deoxyribonuclease [Vibrio cholerae M66-2] gi|227013911|gb|ACP10121.1| Putative deoxyribonuclease [Vibrio cholerae O395] gi|229343693|gb|EEO08668.1| hypothetical protein VCC_003032 [Vibrio cholerae RC9] gi|229351833|gb|EEO16774.1| hypothetical protein VCE_003278 [Vibrio cholerae B33] gi|229355402|gb|EEO20323.1| hypothetical protein VCF_003126 [Vibrio cholerae BX 330286] gi|229370097|gb|ACQ60520.1| hypothetical protein VCD_002353 [Vibrio cholerae MJ-1236] gi|254844806|gb|EET23220.1| conserved hypothetical protein [Vibrio cholerae MO10] gi|255737067|gb|EET92463.1| putative deoxyribonuclease YcfH [Vibrio cholera CIRS 101] gi|262023688|gb|EEY42389.1| putative deoxyribonuclease YcfH [Vibrio cholerae RC27] gi|262031225|gb|EEY49843.1| putative deoxyribonuclease YcfH [Vibrio cholerae INDRE 91/1] gi|297542289|gb|EFH78339.1| conserved hypothetical protein [Vibrio cholerae MAK 757] gi|327484549|gb|AEA78956.1| Putative deoxyribonuclease YcfH [Vibrio cholerae LMA3894-4] Length = 255 Score = 33.4 bits (75), Expect = 9.7, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Query: 1 MLINTHCH---FLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M +++HCH D D +V+ +AHQA V ++++ + Sbjct: 1 MFVDSHCHLDKLDYQDLHADVSDVLDKAHQAKVEYLLSVGV 41 >gi|311106021|ref|YP_003978874.1| hydrolase, TatD family protein [Achromobacter xylosoxidans A8] gi|310760710|gb|ADP16159.1| hydrolase, TatD family protein [Achromobacter xylosoxidans A8] Length = 256 Score = 33.4 bits (75), Expect = 9.7, Method: Composition-based stats. Identities = 8/40 (20%), Positives = 19/40 (47%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 M +++HCH P+ D ++ R V + +++ + Sbjct: 1 MYVDSHCHLNFPELAADLPAILDRMAANQVTHALVVSVNM 40 >gi|229521926|ref|ZP_04411343.1| hypothetical protein VIF_002469 [Vibrio cholerae TM 11079-80] gi|254292086|ref|ZP_04962861.1| conserved hypothetical protein [Vibrio cholerae AM-19226] gi|150421992|gb|EDN13964.1| conserved hypothetical protein [Vibrio cholerae AM-19226] gi|229340851|gb|EEO05856.1| hypothetical protein VIF_002469 [Vibrio cholerae TM 11079-80] Length = 255 Score = 33.4 bits (75), Expect = 9.7, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Query: 1 MLINTHCH---FLLPDFDEDRHNVIMRAHQANVLKMIAIAI 38 M +++HCH D D +V+ +AHQA V ++++ + Sbjct: 1 MFVDSHCHLDKLDYQDLHTDVSDVLAKAHQAKVEYLLSVGV 41 >gi|115923434|ref|XP_780374.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus] gi|115969527|ref|XP_001185014.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus] Length = 275 Score = 33.4 bits (75), Expect = 9.7, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 18/36 (50%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I+ HCH DF ED VI RA V ++ +A Sbjct: 8 FIDCHCHLAADDFKEDIGEVISRAKGNGVEAVLVVA 43 >gi|323494375|ref|ZP_08099486.1| hypothetical protein VIBR0546_15162 [Vibrio brasiliensis LMG 20546] gi|323311379|gb|EGA64532.1| hypothetical protein VIBR0546_15162 [Vibrio brasiliensis LMG 20546] Length = 257 Score = 33.4 bits (75), Expect = 9.9, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 14/33 (42%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMI 34 L +THCH F D I A Q V + I Sbjct: 3 LFDTHCHLDFDCFSADFRQHIESAQQHGVERFI 35 >gi|240145098|ref|ZP_04743699.1| deoxyribonuclease, TatD family [Roseburia intestinalis L1-82] gi|257202770|gb|EEV01055.1| deoxyribonuclease, TatD family [Roseburia intestinalis L1-82] Length = 264 Score = 33.4 bits (75), Expect = 9.9, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 19/43 (44%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 M+ TH H+ F+EDR +I V +I + + T Sbjct: 1 MIFETHAHYDDERFEEDRDALITSMPGRGVGTIINVGASIEST 43 >gi|304397227|ref|ZP_07379106.1| hydrolase, TatD family [Pantoea sp. aB] gi|304355376|gb|EFM19744.1| hydrolase, TatD family [Pantoea sp. aB] Length = 263 Score = 33.4 bits (75), Expect = 10.0, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Query: 2 LINTHCHFLLPDFDE---DRHNVIMRAHQANVLKMIAIAI 38 ++++HCH D+++ D +VI +A +V M+AIA Sbjct: 3 IVDSHCHLDGLDYEKHHRDLDDVIAKAAARDVKFMLAIAT 42 >gi|319762332|ref|YP_004126269.1| hydrolase, tatd family [Alicycliphilus denitrificans BC] gi|330825747|ref|YP_004389050.1| hydrolase, TatD family [Alicycliphilus denitrificans K601] gi|317116893|gb|ADU99381.1| hydrolase, TatD family [Alicycliphilus denitrificans BC] gi|329311119|gb|AEB85534.1| hydrolase, TatD family [Alicycliphilus denitrificans K601] Length = 269 Score = 33.4 bits (75), Expect = 10.0, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 16/41 (39%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVI 41 M +++HCH P+ + A V + + I + Sbjct: 1 MFVDSHCHLNFPELASQLPQIRQAMAAAQVDRALCICTTME 41 >gi|290475846|ref|YP_003468738.1| putative metallo-dependent hydrolase (with domain) [Xenorhabdus bovienii SS-2004] gi|289175171|emb|CBJ81974.1| putative metallo-dependent hydrolase (with domain) [Xenorhabdus bovienii SS-2004] Length = 261 Score = 33.4 bits (75), Expect = 10.0, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Query: 2 LINTHCHFLLPDFD---EDRHNVIMRAHQANVLKMIAIAI 38 L+++HCH D++ + +V+ +A + +V M+A+A Sbjct: 3 LVDSHCHLDCLDYETLHKSVDDVVAKAAERDVKYMLAVAT 42 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.328 0.144 0.446 Lambda K H 0.267 0.0451 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 809,517,035 Number of Sequences: 13984884 Number of extensions: 19550878 Number of successful extensions: 105691 Number of sequences better than 10.0: 1913 Number of HSP's better than 10.0 without gapping: 2068 Number of HSP's successfully gapped in prelim test: 318 Number of HSP's that attempted gapping in prelim test: 103407 Number of HSP's gapped (non-prelim): 2404 length of query: 46 length of database: 4,792,584,752 effective HSP length: 20 effective length of query: 26 effective length of database: 4,512,887,072 effective search space: 117335063872 effective search space used: 117335063872 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.3 bits) S2: 76 (33.7 bits)