RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.91_1 (46 letters) >gnl|CDD|30433 COG0084, TatD, Mg-dependent DNase [DNA replication, recombination, and repair]. Length = 256 Score = 42.1 bits (99), Expect = 3e-05 Identities = 20/39 (51%), Positives = 25/39 (64%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 MLI+THCH +FDEDR VI RA +A V KM+ + Sbjct: 2 MLIDTHCHLDFEEFDEDRDEVIARAREAGVKKMVVVGTD 40 >gnl|CDD|30053 cd01310, TatD_DNAse, TatD like proteins; E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity.. Length = 251 Score = 40.6 bits (95), Expect = 1e-04 Identities = 18/39 (46%), Positives = 26/39 (66%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 LI+THCH P FD DR +V+ RA +A V+K+I + + Sbjct: 1 LIDTHCHLDFPQFDADRDDVLARAREAGVIKIIVVGTDL 39 >gnl|CDD|144567 pfam01026, TatD_DNase, TatD related DNase. This family of proteins are related to a large superfamily of metalloenzymes. TatD, a member of this family has been shown experimentally to be a DNase enzyme. Length = 255 Score = 34.9 bits (81), Expect = 0.005 Identities = 14/35 (40%), Positives = 19/35 (54%) Query: 3 INTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I+ HCH FD DR VI RA +A V ++ + Sbjct: 1 IDAHCHLDFKKFDGDRDEVIERAREAGVTAVVVVG 35 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.338 0.145 0.442 Gapped Lambda K H 0.267 0.0745 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 554,275 Number of extensions: 17819 Number of successful extensions: 93 Number of sequences better than 10.0: 1 Number of HSP's gapped: 93 Number of HSP's successfully gapped: 4 Length of query: 46 Length of database: 6,263,737 Length adjustment: 19 Effective length of query: 27 Effective length of database: 5,853,166 Effective search space: 158035482 Effective search space used: 158035482 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 51 (23.4 bits)