RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.91_1 (46 letters) >gnl|CDD|171118 PRK11449, PRK11449, putative deoxyribonuclease YjjV; Provisional. Length = 258 Score = 36.5 bits (84), Expect = 0.002 Identities = 17/36 (47%), Positives = 20/36 (55%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 I+THCHF P F D + RA QA V K+I A Sbjct: 5 FIDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPA 40 >gnl|CDD|161662 TIGR00010, TIGR00010, hydrolase, TatD family. Several genomes have multiple paralogs related to this family. However, a set of 17 proteins can be found, one each from 17 of the first 20 genomes, such that each member forms a bidirectional best hit across genomes with all other members of the set. This core set (and one other near-perfect member), but not the other paralogs, form the seed for this model. Additionally, members of the seed alignment and all trusted hits, but not all paralogs, have a conserved motif DxHxH near the amino end. The member from E. coli was recently shown to have DNase activity. Length = 252 Score = 34.5 bits (80), Expect = 0.006 Identities = 16/36 (44%), Positives = 21/36 (58%) Query: 2 LINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIA 37 LI+ HCH DF+ED VI RA A V ++A+ Sbjct: 1 LIDAHCHLDFLDFEEDVEEVIERAKAAGVTAVVAVG 36 >gnl|CDD|182449 PRK10425, PRK10425, DNase TatD; Provisional. Length = 258 Score = 27.3 bits (61), Expect = 0.97 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 12 PDFDEDRHNVIMRAHQANVLKMI 34 F +DR +V+ RA A V M+ Sbjct: 11 SQFAKDRDDVVARAFAAGVNGML 33 >gnl|CDD|178630 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional. Length = 697 Score = 25.6 bits (56), Expect = 3.3 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Query: 9 FLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRT 43 LLPD DED V R H + +AIA +I T Sbjct: 612 ELLPDVDEDEEKVSGRYHS----EKLAIAFGLINT 642 >gnl|CDD|177890 PLN02248, PLN02248, cellulose synthase-like protein. Length = 1135 Score = 24.6 bits (54), Expect = 6.2 Identities = 7/16 (43%), Positives = 13/16 (81%) Query: 30 VLKMIAIAIKVIRTLF 45 ++ +IAIA+ V RT++ Sbjct: 1045 MVNLIAIAVGVSRTIY 1060 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.338 0.145 0.442 Gapped Lambda K H 0.267 0.0756 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 733,106 Number of extensions: 27739 Number of successful extensions: 121 Number of sequences better than 10.0: 1 Number of HSP's gapped: 121 Number of HSP's successfully gapped: 9 Length of query: 46 Length of database: 5,994,473 Length adjustment: 19 Effective length of query: 27 Effective length of database: 5,583,921 Effective search space: 150765867 Effective search space used: 150765867 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 50 (23.0 bits)