BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.911_1 (47 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.911_1 Length = 47 Score = 90.9 bits (224), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 47/47 (100%), Positives = 47/47 (100%) Query: 1 LEIVSQVERYAKGANRIRLKVKYSILFLILSALHLKNKVRYGAVKKY 47 LEIVSQVERYAKGANRIRLKVKYSILFLILSALHLKNKVRYGAVKKY Sbjct: 1 LEIVSQVERYAKGANRIRLKVKYSILFLILSALHLKNKVRYGAVKKY 47 >gi|254780134|ref|YP_003064547.1| phage-related integrase/recombinase [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 29.3 bits (64), Expect = 0.014, Method: Composition-based stats. Identities = 13/23 (56%), Positives = 16/23 (69%) Query: 2 EIVSQVERYAKGANRIRLKVKYS 24 + V Q E Y KGA+RIRL +K S Sbjct: 314 KTVDQAETYTKGADRIRLGIKNS 336 >gi|254780424|ref|YP_003064837.1| transcriptional regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 144 Score = 21.6 bits (44), Expect = 2.9, Method: Composition-based stats. Identities = 7/12 (58%), Positives = 10/12 (83%) Query: 6 QVERYAKGANRI 17 QV++Y KG NR+ Sbjct: 43 QVQKYEKGVNRV 54 >gi|254780547|ref|YP_003064960.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 20.4 bits (41), Expect = 5.9, Method: Composition-based stats. Identities = 7/15 (46%), Positives = 13/15 (86%) Query: 21 VKYSILFLILSALHL 35 ++YS +F+ILSA+ + Sbjct: 1 MQYSTIFIILSAITM 15 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.140 0.373 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,033 Number of Sequences: 1233 Number of extensions: 634 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 47 length of database: 328,796 effective HSP length: 20 effective length of query: 27 effective length of database: 304,136 effective search space: 8211672 effective search space used: 8211672 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 31 (16.5 bits)