BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.913_1
         (102 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|198416309|ref|XP_002123970.1| PREDICTED: similar to integrin alpha Hr2 [Ciona intestinalis]
          Length = 1104

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 16/80 (20%)

Query: 15  IFSFLALFGSSV--SFFSCSENCFLGFSCDS--ITFFSC-SESSFFSFSAD--SDSKAMW 67
           I+S  A+ GS V  SFF C   C L F+ D+   TFFS  + +S+F F+ D  S++   W
Sbjct: 63  IYSKFAVGGSFVWYSFFLCMLRCALSFNLDAEFPTFFSGPAHNSYFGFAVDYYSEASQTW 122

Query: 68  ---------GRGELFKLSSS 78
                      GE+FK +++
Sbjct: 123 VVVGAPRNGFNGEVFKCTNT 142


>gi|255712695|ref|XP_002552630.1| KLTH0C09416p [Lachancea thermotolerans]
 gi|238934009|emb|CAR22192.1| KLTH0C09416p [Lachancea thermotolerans]
          Length = 922

 Score = 34.3 bits (77), Expect = 5.8,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 2/70 (2%)

Query: 32  SENCFLGFSCDSITFFSCSESSFFSFSADSDSKAMWGRGELFKLSSSMPHGFIALLTN-- 89
           SEN FL   CD +  F  +         D D +A++G   L +L +   +  I  +    
Sbjct: 766 SENSFLNIVCDEVKKFDIANILTLYLVKDEDKEAVFGENLLDELMTFNDYETIDRIVKEE 825

Query: 90  NIVKIVKYFF 99
           N+VKI+KY+ 
Sbjct: 826 NVVKILKYYL 835


Searching..................................................done



 ***** No hits found ******

  Database: nr
    Posted date:  May 13, 2011  4:10 AM
  Number of letters in database: 999,999,932
  Number of sequences in database:  2,987,209
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 13, 2011  4:17 AM
  Number of letters in database: 999,998,956
  Number of sequences in database:  2,896,973
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 13, 2011  4:23 AM
  Number of letters in database: 999,999,979
  Number of sequences in database:  2,907,862
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 13, 2011  4:29 AM
  Number of letters in database: 999,999,513
  Number of sequences in database:  2,932,190
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 13, 2011  4:33 AM
  Number of letters in database: 792,586,372
  Number of sequences in database:  2,260,650
  
Lambda     K      H
   0.333    0.141    0.454 

Lambda     K      H
   0.267   0.0451    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,106,301,423
Number of Sequences: 13984884
Number of extensions: 82663046
Number of successful extensions: 342908
Number of sequences better than 10.0: 59
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 56
Number of HSP's that attempted gapping in prelim test: 342816
Number of HSP's gapped (non-prelim): 138
length of query: 102
length of database: 4,792,584,752
effective HSP length: 71
effective length of query: 31
effective length of database: 3,799,657,988
effective search space: 117789397628
effective search space used: 117789397628
T: 11
A: 40
X1: 16 ( 7.7 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 76 (33.7 bits)