BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 537021.9.peg.913_1 (102 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|198416309|ref|XP_002123970.1| PREDICTED: similar to integrin alpha Hr2 [Ciona intestinalis] Length = 1104 Score = 35.0 bits (79), Expect = 3.1, Method: Composition-based stats. Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 16/80 (20%) Query: 15 IFSFLALFGSSV--SFFSCSENCFLGFSCDS--ITFFSC-SESSFFSFSAD--SDSKAMW 67 I+S A+ GS V SFF C C L F+ D+ TFFS + +S+F F+ D S++ W Sbjct: 63 IYSKFAVGGSFVWYSFFLCMLRCALSFNLDAEFPTFFSGPAHNSYFGFAVDYYSEASQTW 122 Query: 68 ---------GRGELFKLSSS 78 GE+FK +++ Sbjct: 123 VVVGAPRNGFNGEVFKCTNT 142 >gi|255712695|ref|XP_002552630.1| KLTH0C09416p [Lachancea thermotolerans] gi|238934009|emb|CAR22192.1| KLTH0C09416p [Lachancea thermotolerans] Length = 922 Score = 34.3 bits (77), Expect = 5.8, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Query: 32 SENCFLGFSCDSITFFSCSESSFFSFSADSDSKAMWGRGELFKLSSSMPHGFIALLTN-- 89 SEN FL CD + F + D D +A++G L +L + + I + Sbjct: 766 SENSFLNIVCDEVKKFDIANILTLYLVKDEDKEAVFGENLLDELMTFNDYETIDRIVKEE 825 Query: 90 NIVKIVKYFF 99 N+VKI+KY+ Sbjct: 826 NVVKILKYYL 835 Searching..................................................done ***** No hits found ****** Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.333 0.141 0.454 Lambda K H 0.267 0.0451 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,106,301,423 Number of Sequences: 13984884 Number of extensions: 82663046 Number of successful extensions: 342908 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 56 Number of HSP's that attempted gapping in prelim test: 342816 Number of HSP's gapped (non-prelim): 138 length of query: 102 length of database: 4,792,584,752 effective HSP length: 71 effective length of query: 31 effective length of database: 3,799,657,988 effective search space: 117789397628 effective search space used: 117789397628 T: 11 A: 40 X1: 16 ( 7.7 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 76 (33.7 bits)