RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.913_1 (102 letters) >gnl|CDD|109783 pfam00739, X, Trans-activation protein X. This protein is found in hepadnaviruses where it is indispensable for replication. Length = 142 Score = 25.7 bits (56), Expect = 2.9 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 17 SFLALFGSSVSFFSCSENCFLGFSC 41 + L+L G V FS + C L F+ Sbjct: 51 ADLSLRGLPVCAFSSAGPCALRFTS 75 >gnl|CDD|36596 KOG1382, KOG1382, KOG1382, Multiple inositol polyphosphate phosphatase [General function prediction only]. Length = 467 Score = 24.1 bits (52), Expect = 9.2 Identities = 17/73 (23%), Positives = 30/73 (41%), Gaps = 3/73 (4%) Query: 25 SVSFFSCS-ENCFLGFSCDSITFFSCSESSFFSFSADSDSKAMWGRGELFKLSSSMPHGF 83 S FF C+ E G+ D F+ E F D + +G G ++L+SS+ Sbjct: 258 SSLFFWCAYEIALKGYRSDWCDIFTPDE--LLVFEYLEDLEYYYGDGYGYELNSSLGCPL 315 Query: 84 IALLTNNIVKIVK 96 L ++ + + Sbjct: 316 FNDLLKSLRESEE 328 >gnl|CDD|29618 cd01571, NAPRTase_B, Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B. Nicotinate phosphoribosyltransferase catalyses the formation of NAMN and PPi from 5-phosphoribosy -1-pyrophosphate (PRPP) and nicotinic acid, this is the first, and also rate limiting, reaction in the NAD salvage synthesis. This salvage pathway serves to recycle NAD degradation products.. Length = 302 Score = 24.0 bits (52), Expect = 9.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 74 KLSSSMPHGFIALLTNNIVKIVKYF 98 K S +MPH I + + V+ K F Sbjct: 153 KPSGTMPHALIQIFGGDQVEAWKAF 177 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.333 0.141 0.454 Gapped Lambda K H 0.267 0.0692 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,303,088 Number of extensions: 61414 Number of successful extensions: 421 Number of sequences better than 10.0: 1 Number of HSP's gapped: 407 Number of HSP's successfully gapped: 74 Length of query: 102 Length of database: 6,263,737 Length adjustment: 69 Effective length of query: 33 Effective length of database: 4,772,716 Effective search space: 157499628 Effective search space used: 157499628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 51 (23.5 bits)