RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.913_1 (102 letters) >gnl|CDD|177810 PLN00417, PLN00417, oxidoreductase, 2OG-Fe(II) oxygenase family protein. Length = 348 Score = 26.1 bits (57), Expect = 2.4 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Query: 68 GRGELFKLSSS---------MPHGFIALLTNNIVKIVKYFFI 100 GR EL KL S+ M HG + I K+ K FF Sbjct: 60 GREELSKLHSALSTWGVVQVMNHGITEAFLDKIYKLTKQFFA 101 >gnl|CDD|151295 pfam10846, DUF2722, Protein of unknown function (DUF2722). This eukaryotic family of proteins has no known function. Length = 374 Score = 25.6 bits (56), Expect = 2.8 Identities = 6/19 (31%), Positives = 11/19 (57%) Query: 19 LALFGSSVSFFSCSENCFL 37 L+L G +V+ + SE + Sbjct: 29 LSLLGPNVTNWPYSEEALI 47 >gnl|CDD|181437 PRK08470, PRK08470, adenylosuccinate lyase; Provisional. Length = 442 Score = 25.1 bits (55), Expect = 4.0 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Query: 74 KLSSSMPHGFIALLTNNIV---KIVKYFFIPS 102 K SS+MPH +L+ NI ++++ F P+ Sbjct: 260 KGSSAMPHKRNPVLSENITGLCRVIRSFATPA 291 >gnl|CDD|181064 PRK07638, PRK07638, acyl-CoA synthetase; Validated. Length = 487 Score = 25.1 bits (55), Expect = 4.3 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 46 FFSCSESSFFSFSADSDSK 64 F+ SE SF + D +S+ Sbjct: 285 FYGASELSFVTALVDEESE 303 >gnl|CDD|180868 PRK07188, PRK07188, nicotinate phosphoribosyltransferase; Provisional. Length = 352 Score = 24.1 bits (53), Expect = 7.9 Identities = 6/21 (28%), Positives = 12/21 (57%) Query: 78 SMPHGFIALLTNNIVKIVKYF 98 +MPH I + ++V+ K + Sbjct: 176 TMPHALIQMFNGDVVEACKAY 196 >gnl|CDD|148146 pfam06367, Drf_FH3, Diaphanous FH3 Domain. This region is found in the Formin-like and and diaphanous proteins. Length = 197 Score = 23.8 bits (52), Expect = 9.7 Identities = 7/28 (25%), Positives = 12/28 (42%) Query: 22 FGSSVSFFSCSENCFLGFSCDSITFFSC 49 F S V SEN + + ++ F + Sbjct: 23 FQSLVGALDSSENDNVEYKVATMQFINA 50 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.333 0.141 0.454 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,574,054 Number of extensions: 79978 Number of successful extensions: 378 Number of sequences better than 10.0: 1 Number of HSP's gapped: 377 Number of HSP's successfully gapped: 41 Length of query: 102 Length of database: 5,994,473 Length adjustment: 69 Effective length of query: 33 Effective length of database: 4,503,521 Effective search space: 148616193 Effective search space used: 148616193 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 50 (23.0 bits)