RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= 537021.9.peg.913_1 (102 letters) >g1tme.1 b.121.4.1 (4:,2:) Theilovirus capsid proteins {Theiler's murine encephalomyelitis virus, strain da [TaxId: 12124]} Length = 280 Score = 25.1 bits (55), Expect = 1.7 Identities = 6/16 (37%), Positives = 8/16 (50%) Query: 80 PHGFIALLTNNIVKIV 95 PH + L TN V + Sbjct: 204 PHQILNLRTNTTVDLE 219 >g1aym.1 b.121.4.1 (4:,2:) Rhinovirus coat proteins {Human rhinovirus 16, (HRV-16) [TaxId: 31708]} Length = 296 Score = 24.8 bits (54), Expect = 2.0 Identities = 7/16 (43%), Positives = 10/16 (62%) Query: 80 PHGFIALLTNNIVKIV 95 PH FI L +NN ++ Sbjct: 221 PHQFINLRSNNSATLI 236 >g1ncq.1 b.121.4.1 (D:,B:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]} Length = 295 Score = 24.4 bits (53), Expect = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Query: 80 PHGFIALLTNNIVKIV 95 PH FI L TNN IV Sbjct: 218 PHQFINLRTNNTATIV 233 >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 Score = 24.3 bits (52), Expect = 3.1 Identities = 5/30 (16%), Positives = 10/30 (33%) Query: 57 FSADSDSKAMWGRGELFKLSSSMPHGFIAL 86 ++ + RG+L HG + Sbjct: 120 WTVVNGDPVRMSRGDLLLTPGWCFHGHMND 149 >g1pvc.1 b.121.4.1 (4:,2:) Poliovirus coat proteins {Poliovirus type 3, strain Sabin [TaxId: 12086]} Length = 334 Score = 24.0 bits (52), Expect = 3.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Query: 80 PHGFIALLTNNIVKIV 95 PH I L TNN IV Sbjct: 256 PHQIINLRTNNSATIV 271 >g1d4m.1 b.121.4.1 (4:,2:) Human enterovirus B coat proteins {Human coxsackievirus A9 [TaxId: 12067]} Length = 320 Score = 23.2 bits (50), Expect = 5.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 80 PHGFIALLTNNIVKIV 95 PH +I L TNN IV Sbjct: 245 PHQWINLRTNNSATIV 260 >d1tlqa_ a.195.1.1 (A:) Hypothetical protein YpjQ {Bacillus subtilis [TaxId: 1423]} Length = 161 Score = 23.1 bits (50), Expect = 7.4 Identities = 8/30 (26%), Positives = 11/30 (36%) Query: 71 ELFKLSSSMPHGFIALLTNNIVKIVKYFFI 100 E+ LS +G I L + K I Sbjct: 95 EIIPLSIVNVYGSIGLTNFGYLDKEKIGII 124 >d1y9ia_ a.195.1.1 (A:) Low temperature requirement C protein, LtrC {Listeria monocytogenes [TaxId: 1639]} Length = 159 Score = 22.7 bits (49), Expect = 7.6 Identities = 7/30 (23%), Positives = 11/30 (36%) Query: 71 ELFKLSSSMPHGFIALLTNNIVKIVKYFFI 100 E+ LS +G I + VK + Sbjct: 94 EILALSIVNVYGSIGFTNYGYIDKVKPGIL 123 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.333 0.141 0.454 Gapped Lambda K H 0.267 0.0649 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 379,088 Number of extensions: 14108 Number of successful extensions: 52 Number of sequences better than 10.0: 1 Number of HSP's gapped: 52 Number of HSP's successfully gapped: 17 Length of query: 102 Length of database: 2,407,596 Length adjustment: 63 Effective length of query: 39 Effective length of database: 1,542,606 Effective search space: 60161634 Effective search space used: 60161634 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 47 (22.1 bits)