Query         537021.9.peg.930_1
Match_columns 51
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 39220
Date          Wed May 25 07:11:08 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_930.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01314 gntK_FGGY gluconate   57.5    0.67 1.7E-05   25.7  -3.3   13    9-21    272-284 (506)
  2 TIGR01394 TypA_BipA GTP-bindin  42.6       4  0.0001   21.6  -1.2   17    2-18    506-522 (609)
  3 pfam10452 TCO89 TORC1 subunit   33.1      21 0.00052   17.9   1.2   29   20-48    314-343 (457)
  4 cd07643 I-BAR_IMD_MIM Inverse   32.9      25 0.00063   17.5   1.5   27   10-37    183-212 (231)
  5 pfam02701 zf-Dof Dof domain, z  24.4      33 0.00084   16.8   1.0   15    4-19     20-34  (63)
  6 TIGR00940 2a6301s01 monovalent  21.3      42  0.0011   16.2   1.0   37   10-46    103-157 (809)
  7 TIGR02643 T_phosphoryl thymidi  19.9      23  0.0006   17.6  -0.5   14    1-14     43-56  (440)
  8 pfam08397 IMD IRSp53/MIM homol  15.8      91  0.0023   14.5   1.7   14   10-24    170-183 (218)
  9 pfam11161 DUF2944 Protein of u  14.1      24  0.0006   17.5  -1.7   16    2-17     54-69  (178)
 10 KOG3917 consensus               12.0 1.1E+02  0.0027   14.1   1.1   10   18-27     24-33  (310)

No 1  
>TIGR01314 gntK_FGGY gluconate kinase; InterPro: IPR006002    Gluconate kinase (2.7.1.12 from EC) is an alpha/beta structure consisting of a twisted parallel beta-sheet surrounded by alpha-helices with overall topology similar to nucleoside monophosphate (NMP) kinases, such as adenylate kinase. Significant conformational changes are induced upon binding of ATP to the enzyme. The largest changes involve a hinge-bending motion of the NMP(bind) part and a motion of the LID with adjacent helices, which opens the cavity to the second substrate, gluconate. The opening of the active site cleft upon ATP binding is the opposite of what has been observed in the NMP kinase family so far, which usually close their active site to prevent fortuitous hydrolysis of ATP. The beta and gamma-phosphate groups of ATP bind in the predicted P-loop. A conserved lysine side-chain interacts with the gamma-phosphate group, and might promote phosphoryl transfer.  ATP + D-gluconate = ADP + 6-phospho-D-gluconate.  Gluconate-6-phosphate binds with its phosphate group in a similar position as the gamma-phosphate of ATP, consistent with inline phosphoryl transfer. . ; GO: 0019200 carbohydrate kinase activity, 0019521 D-gluconate metabolic process.
Probab=57.54  E-value=0.67  Score=25.67  Aligned_cols=13  Identities=62%  Similarity=1.301  Sum_probs=8.6

Q ss_pred             CHHHHHHHHHHHH
Q ss_conf             8423033999999
Q 537021.9.peg.9    9 NLDERGRFFCYFL   21 (51)
Q Consensus         9 nldergrffcyfl   21 (51)
                      .-||+||.|||-|
T Consensus       272 ~TD~KGR~F~Y~L  284 (506)
T TIGR01314       272 KTDEKGRIFCYAL  284 (506)
T ss_pred             CCCCCCCEEEEEE
T ss_conf             7587874688998


No 2  
>TIGR01394 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298   This bacterial (and Arabidopsis) protein, termed TypA or BipA, is a GTP-binding protein. It is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways, but the precise function is unknown.; GO: 0005525 GTP binding, 0005622 intracellular.
Probab=42.57  E-value=4  Score=21.58  Aligned_cols=17  Identities=47%  Similarity=0.806  Sum_probs=12.9

Q ss_pred             CEEECCCCHHHHHHHHH
Q ss_conf             21213668423033999
Q 537021.9.peg.9    2 AFFFNNYNLDERGRFFC   18 (51)
Q Consensus         2 afffnnynldergrffc   18 (51)
                      |..|-=+||.|||+||-
T Consensus       506 a~~YaL~nLqeRG~~Fv  522 (609)
T TIGR01394       506 ATAYALWNLQERGRLFV  522 (609)
T ss_pred             HHHHHHHHHHHCCCEEE
T ss_conf             06676873875384330


No 3  
>pfam10452 TCO89 TORC1 subunit TCO89. TC089 is a component of the TORC1 complex. TORC1 is responsible for a wide range of rapamycin-sensitive cellular activities.
Probab=33.05  E-value=21  Score=17.87  Aligned_cols=29  Identities=45%  Similarity=0.540  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHHH-HHHHHHHHHHHHHH
Q ss_conf             999999985667799-99999999998874
Q 537021.9.peg.9   20 FLSLLIVDTLRSFSL-FQHLWLKRLSSILV   48 (51)
Q Consensus        20 flsllivdtlrsfsl-fqhlwlkrlssilv   48 (51)
                      |-+.|--|..-.-|- -|.|||.|-+||+-
T Consensus       314 FsqFLks~~~d~~SRTQqKLwLQREsSi~D  343 (457)
T pfam10452       314 FSQFLKSDDIDGDSRTQQKLWLQRESSILD  343 (457)
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             999860178886138889998852201210


No 4  
>cd07643 I-BAR_IMD_MIM Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Missing In Metastasis. The IMD domain, also called Inverse-Bin/Amphiphysin/Rvs (I-BAR) domain, is a dimerization and lipid-binding module that bends membranes and induces membrane protrusions. Members of this subfamily include missing in metastasis (MIM) or metastasis suppressor 1 (MTSS1), metastasis suppressor 1-like (MTSSL) or ABBA (Actin-Bundling protein with BAIAP2 homology), and similar proteins. They contain an N-terminal IMD and a WASP homology 2 (WH2) actin-binding motif at the C-terminus. MIM was originally identified as a missing transcript from metastatic bladder and prostate cancer cells. It is a scaffold protein that functions in a signaling pathway between the PDGF receptor, Src kinases, and actin assembly. It may also function as a cofactor of the Sonic hedgehog (Shh) transcriptional pathway and may participate in tumor development and progression via this pathway. ABBA regulate
Probab=32.92  E-value=25  Score=17.45  Aligned_cols=27  Identities=41%  Similarity=0.863  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHH--HH-HHHHHHHHHH
Q ss_conf             4230339999999999--98-5667799999
Q 537021.9.peg.9   10 LDERGRFFCYFLSLLI--VD-TLRSFSLFQH   37 (51)
Q Consensus        10 ldergrffcyflslli--vd-tlrsfslfqh   37 (51)
                      +.||+| ||+|.+.+-  +| -+--++--.|
T Consensus       183 iEER~R-~C~fV~~l~pV~~~e~~ml~e~~h  212 (231)
T cd07643         183 IEERGR-FCTFVSFLKPVLDEEISMLGEVTH  212 (231)
T ss_pred             HHHHHH-HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999878-999998732788899999966988


No 5  
>pfam02701 zf-Dof Dof domain, zinc finger. The Dof domain is a zinc finger DNA-binding domain, that shows resemblance to the Cys2 zinc finger.
Probab=24.42  E-value=33  Score=16.78  Aligned_cols=15  Identities=53%  Similarity=1.373  Sum_probs=11.5

Q ss_pred             EECCCCHHHHHHHHHH
Q ss_conf             2136684230339999
Q 537021.9.peg.9    4 FFNNYNLDERGRFFCY   19 (51)
Q Consensus         4 ffnnynldergrffcy   19 (51)
                      +|||||+.. -|+||-
T Consensus        20 YyNNy~~~Q-PR~~Ck   34 (63)
T pfam02701        20 YYNNYNLNQ-PRYFCK   34 (63)
T ss_pred             EECCCCCCC-CHHHHH
T ss_conf             565888776-257878


No 6  
>TIGR00940 2a6301s01 monovalent cation:proton antiporter; InterPro: IPR005663    This family of proteins consists of bacterial multicomponent K+:H+ and Na+:H+ antiporters. The best characterised systems are the PhaABCDEFG system of Rhizobium meliloti which functions in pH adaptation and as a K+ efflux system and the MnhABCDEFG system of Staphylococcus aureus which functions as a Na+:H+ antiporter.; GO: 0015077 monovalent inorganic cation transmembrane transporter activity, 0030004 cellular monovalent inorganic cation homeostasis.
Probab=21.35  E-value=42  Score=16.23  Aligned_cols=37  Identities=27%  Similarity=0.579  Sum_probs=20.4

Q ss_pred             HHHHHHHHHHHHHHH-------HHH---------HHHHHH--HHHHHHHHHHHHH
Q ss_conf             423033999999999-------998---------566779--9999999999988
Q 537021.9.peg.9   10 LDERGRFFCYFLSLL-------IVD---------TLRSFS--LFQHLWLKRLSSI   46 (51)
Q Consensus        10 ldergrffcyflsll-------ivd---------tlrsfs--lfqhlwlkrlssi   46 (51)
                      -|.-+|||||+|--.       .-|         .|.|++  |.---|-.|-.|+
T Consensus       103 ~e~l~nFy~ylL~FMGaMLGVVLSdNlI~LyvFWELTS~~SfLLIsyW~hr~~s~  157 (809)
T TIGR00940       103 EEKLPNFYVYLLLFMGAMLGVVLSDNLIVLYVFWELTSLASFLLISYWFHREKSR  157 (809)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             2676169999999953565467877899999999999999999988887468888


No 7  
>TIGR02643 T_phosphoryl thymidine phosphorylase; InterPro: IPR013465    Thymidine phosphorylase (alternate name: pyrimidine phosphorylase) 2.4.2.4 from EC is involved, in E. coli and other Proteobacteria, in (deoxy)nucleotide degradation. It is often encoded in an operon together with a deoxyribose-phosphate aldolase, a phosphopentomutase and a purine nucleoside phosphorylase. In many other lineages, the corresponding enzyme is designated pyrimidine-nucleoside phosphorylase (2.4.2.2 from EC); the naming convention here follows standard literature practice.; GO: 0009032 thymidine phosphorylase activity.
Probab=19.90  E-value=23  Score=17.58  Aligned_cols=14  Identities=57%  Similarity=0.814  Sum_probs=11.7

Q ss_pred             CCEEECCCCHHHHH
Q ss_conf             92121366842303
Q 537021.9.peg.9    1 MAFFFNNYNLDERG   14 (51)
Q Consensus         1 mafffnnynlderg   14 (51)
                      ||.|||.-|++|+=
T Consensus        43 MAvyF~gm~~~E~v   56 (440)
T TIGR02643        43 MAVYFNGMNRDERV   56 (440)
T ss_pred             HHHHHCCCCHHHHH
T ss_conf             99984388844789


No 8  
>pfam08397 IMD IRSp53/MIM homology domain. The N-terminal predicted helical stretch of the insulin receptor tyrosine kinase substrate p53 (IRSp53) is an evolutionary conserved F-actin bundling domain involved in filopodium formation. The domain has been named IMD after the IRSp53 and missing in metastasis (MIM) proteins in which it occurs. Filopodium-inducing IMD activity is regulated by Cdc42 and Rac1 and is SH3-independent.
Probab=15.82  E-value=91  Score=14.48  Aligned_cols=14  Identities=36%  Similarity=0.966  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             423033999999999
Q 537021.9.peg.9   10 LDERGRFFCYFLSLL   24 (51)
Q Consensus        10 ldergrffcyflsll   24 (51)
                      +.||+| ||+|++-+
T Consensus       170 ~EERrR-ycflv~~~  183 (218)
T pfam08397       170 LEEKRR-FCFLVDKH  183 (218)
T ss_pred             HHHHHH-HHHHHHHH
T ss_conf             999989-99999998


No 9  
>pfam11161 DUF2944 Protein of unknown function (DUF2946). This family of proteins with unknown function appear to be restricted to Proteobacteria.
Probab=14.09  E-value=24  Score=17.54  Aligned_cols=16  Identities=44%  Similarity=0.939  Sum_probs=12.3

Q ss_pred             CEEECCCCHHHHHHHH
Q ss_conf             2121366842303399
Q 537021.9.peg.9    2 AFFFNNYNLDERGRFF   17 (51)
Q Consensus         2 afffnnynldergrff   17 (51)
                      +|.-.||.-|++||.|
T Consensus        54 ~FI~RNY~~D~~G~Wf   69 (178)
T pfam11161        54 EFIARNYECDAQGRWF   69 (178)
T ss_pred             HHHHHCCCCCCCCCEE
T ss_conf             9998446767777678


No 10 
>KOG3917 consensus
Probab=11.96  E-value=1.1e+02  Score=14.14  Aligned_cols=10  Identities=80%  Similarity=1.667  Sum_probs=0.0

Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999998
Q 537021.9.peg.9   18 CYFLSLLIVD   27 (51)
Q Consensus        18 cyflsllivd   27 (51)
                      |||+||+..|
T Consensus        24 ~~flsLl~L~   33 (310)
T KOG3917          24 CYFLSLLVLD   33 (310)
T ss_pred             HHHHHHHHHC
T ss_conf             8989887624


Done!