Query 537021.9.peg.937_1 Match_columns 48 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 08:13:14 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_937.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam05814 DUF843 Baculovirus p 65.9 7.6 0.00019 20.5 3.4 38 5-42 11-49 (83) 2 TIGR02125 CytB-hydogenase Ni/F 35.0 11 0.00028 19.7 0.0 14 33-46 23-36 (229) 3 pfam11846 DUF3366 Domain of un 33.8 25 0.00064 17.9 1.7 16 21-36 3-18 (193) 4 pfam07327 Neuroparsin Neuropar 31.2 25 0.00063 17.9 1.3 15 21-35 10-24 (103) 5 PRK10171 hydrogenase 1 b-type 22.8 34 0.00087 17.2 0.8 16 28-43 29-44 (235) 6 KOG4821 consensus 17.8 79 0.002 15.3 1.8 20 18-37 84-103 (287) 7 pfam09980 DUF2214 Predicted me 16.6 55 0.0014 16.1 0.7 20 25-44 61-80 (150) 8 TIGR02785 addA_Gpos recombinat 16.0 1E+02 0.0026 14.8 2.0 28 12-43 104-132 (1295) 9 TIGR02546 III_secr_ATP type II 11.5 87 0.0022 15.1 0.6 8 3-10 320-327 (430) 10 pfam05704 Caps_synth Capsular 10.8 1.7E+02 0.0043 13.7 2.1 36 12-47 104-139 (279) No 1 >pfam05814 DUF843 Baculovirus protein of unknown function (DUF843). This family consists of several Baculovirus proteins of around 85 residues long with no known function. Probab=65.91 E-value=7.6 Score=20.49 Aligned_cols=38 Identities=29% Similarity=0.390 Sum_probs=29.4 Q ss_pred HHHHHHCCCC-HHHHHHHHHHHHHHHHHHCCHHHCCCCE Q ss_conf 7767641700-1367799999999998500001005851 Q 537021.9.peg.9 5 ILDGFFSNKS-RMSTLHLFILIKVILFHSMTGYYIDNPL 42 (48) Q Consensus 5 ildgffsnks-rmstlhlfilikvilfhsmtgyyidnpl 42 (48) |+=||.-||. +.|.+-+|+|+-.++|--|..+|.-||- T Consensus 11 iv~~fi~dk~e~~s~li~~~lllfvlF~~~l~vyyinte 49 (83) T pfam05814 11 IVLAFIFDKNEGSSELILTLLVLFVLFFCLLNVYYINTE 49 (83) T ss_pred HHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 999999704566278999999999999998776403897 No 2 >TIGR02125 CytB-hydogenase Ni/Fe-hydrogenase, b-type cytochrome subunit; InterPro: IPR000516 Bacterial membrane-bound nickel-dependent hydrogenases , , seem to be associated with a b-type cytochrome involved in electron transfer from hydrogen to oxygen. This cytochrome is a protein of about 28 kDa that seems to have four transmembrane regions, which include several histidine residues that may be involved in coordination of the haem iron group. The gene coding for this cytochrome is adjacent to that coding for the large subunit of the hydrogenase. It has been assigned a variety of names in different species: hupC, hyaC, hydC or hoxZ. Every genome which contains a member of this family posesses a Ni/Fe hydrogenase according to Genome Properties (GenProp0177), and most are gene clustered with other hydrogenase components. Some Ni/Fe hydrogenase-containing species lack a member of this family but contain other CytB homologs, which may substitute for it.; GO: 0016491 oxidoreductase activity, 0006118 electron transport, 0016020 membrane. Probab=34.97 E-value=11 Score=19.70 Aligned_cols=14 Identities=36% Similarity=0.892 Sum_probs=11.0 Q ss_pred CCHHHCCCCEECCC Q ss_conf 00010058511234 Q 537021.9.peg.9 33 MTGYYIDNPLFCSE 46 (48) Q Consensus 33 mtgyyidnplfcse 46 (48) .|||||-+|+-... T Consensus 23 ~TGfYIA~Pf~~~~ 36 (229) T TIGR02125 23 VTGFYIAYPFLSPP 36 (229) T ss_pred HHHHHHHCCCCCCC T ss_conf 99998740037897 No 3 >pfam11846 DUF3366 Domain of unknown function (DUF3366). This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is about 200 amino acids in length. Probab=33.84 E-value=25 Score=17.87 Aligned_cols=16 Identities=44% Similarity=0.746 Sum_probs=9.7 Q ss_pred HHHHHHHHHHHHCCHH Q ss_conf 9999999998500001 Q 537021.9.peg.9 21 LFILIKVILFHSMTGY 36 (48) Q Consensus 21 lfilikvilfhsmtgy 36 (48) ++-++-+|+.|||+-| T Consensus 3 llall~pI~lHSmlEy 18 (193) T pfam11846 3 LLALLAPIVLHSMLEY 18 (193) T ss_pred HHHHHHHHHHHHHHHH T ss_conf 9999999999996638 No 4 >pfam07327 Neuroparsin Neuroparsin. This family consists of several locust specific neuroparsin proteins. Neuroparsins are produced by the A1 type of protocerebral median neurosecretory cells of the PI-CC system and display pleiotropic activities: inhibition of the effect of juvenile hormone, stimulation of fluid reabsorption of isolated recta, induction of an increase in hemolymph lipid and trehalose levels, and neurotrophic effects. Probab=31.23 E-value=25 Score=17.90 Aligned_cols=15 Identities=47% Similarity=0.687 Sum_probs=11.4 Q ss_pred HHHHHHHHHHHHCCH Q ss_conf 999999999850000 Q 537021.9.peg.9 21 LFILIKVILFHSMTG 35 (48) Q Consensus 21 lfilikvilfhsmtg 35 (48) --.||.|||||.... T Consensus 10 atlliavilfhraea 24 (103) T pfam07327 10 ATLLIAVILFHRAEA 24 (103) T ss_pred HHHHHHHHHHHHHCC T ss_conf 999999998535016 No 5 >PRK10171 hydrogenase 1 b-type cytochrome subunit; Provisional Probab=22.79 E-value=34 Score=17.18 Aligned_cols=16 Identities=38% Similarity=0.717 Sum_probs=11.7 Q ss_pred HHHHHCCHHHCCCCEE Q ss_conf 9985000010058511 Q 537021.9.peg.9 28 ILFHSMTGYYIDNPLF 43 (48) Q Consensus 28 ilfhsmtgyyidnplf 43 (48) |.--+.|||||.+|+. T Consensus 29 I~vL~iTG~yIg~P~~ 44 (235) T PRK10171 29 MAVLMVTGYFIGKPLP 44 (235) T ss_pred HHHHHHHHHHHCCCCC T ss_conf 9999999985337887 No 6 >KOG4821 consensus Probab=17.81 E-value=79 Score=15.32 Aligned_cols=20 Identities=45% Similarity=0.668 Sum_probs=15.1 Q ss_pred HHHHHHHHHHHHHHHCCHHH Q ss_conf 77999999999985000010 Q 537021.9.peg.9 18 TLHLFILIKVILFHSMTGYY 37 (48) Q Consensus 18 tlhlfilikvilfhsmtgyy 37 (48) .|||||+|-..+|..-+-|. T Consensus 84 ~LhLFilI~~Ll~tPs~~~L 103 (287) T KOG4821 84 RLHLFILILSLLITPSIVYL 103 (287) T ss_pred CHHHHHHHHHHHHHHHHHHH T ss_conf 13799999999972899999 No 7 >pfam09980 DUF2214 Predicted membrane protein (DUF2214). This domain, found in various hypothetical bacterial proteins, has no known function. Probab=16.61 E-value=55 Score=16.14 Aligned_cols=20 Identities=35% Similarity=0.833 Sum_probs=14.4 Q ss_pred HHHHHHHHCCHHHCCCCEEC Q ss_conf 99999850000100585112 Q 537021.9.peg.9 25 IKVILFHSMTGYYIDNPLFC 44 (48) Q Consensus 25 ikvilfhsmtgyyidnplfc 44 (48) ..|.-|-.-..||..||+|- T Consensus 61 lRv~~~~KG~~fY~~nP~Fh 80 (150) T pfam09980 61 LRVFYFGKGSEFYLHNPLFH 80 (150) T ss_pred HHHHHHCCHHHHHHCCHHHH T ss_conf 99999154089996390999 No 8 >TIGR02785 addA_Gpos recombination helicase AddA; InterPro: IPR014152 AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologues between the Firmicutes and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species.. Probab=16.03 E-value=1e+02 Score=14.78 Aligned_cols=28 Identities=57% Similarity=0.839 Sum_probs=17.5 Q ss_pred CCCHHHHHHHHHHHHHHHHHHCCHHHCC-CCEE Q ss_conf 7001367799999999998500001005-8511 Q 537021.9.peg.9 12 NKSRMSTLHLFILIKVILFHSMTGYYID-NPLF 43 (48) Q Consensus 12 nksrmstlhlfilikvilfhsmtgyyid-nplf 43 (48) |+...||||-|.| +||-=| +|-|| +|-| T Consensus 104 ~~A~ISTlhsFCL-~Vir~~---YYllDlDP~F 132 (1295) T TIGR02785 104 NKANISTLHSFCL-KVIRKH---YYLLDLDPSF 132 (1295) T ss_pred CCCCCHHHHHHHH-HHHHHH---CCEEECCCCC T ss_conf 6765104578999-997666---0435537887 No 9 >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase; InterPro: IPR013380 Proteins in this entry are found in a variety of bacteria, and are predicted to be ATPases involved in type III secretion systems. One example is YscN (P40290 from SWISSPROT) from Yersinia enterocolitica, which is thought to energise the YOP (Yersinia outer protein) secretion system .; GO: 0046961 hydrogen ion transporting ATPase activity rotational mechanism, 0030254 protein secretion by the type III secretion system. Probab=11.54 E-value=87 Score=15.10 Aligned_cols=8 Identities=63% Similarity=1.045 Sum_probs=0.0 Q ss_pred HHHHHHHH Q ss_conf 66776764 Q 537021.9.peg.9 3 KSILDGFF 10 (48) Q Consensus 3 ksildgff 10 (48) +|||||.| T Consensus 320 RSILDGHI 327 (430) T TIGR02546 320 RSILDGHI 327 (430) T ss_pred HHHHHHHH T ss_conf 44542368 No 10 >pfam05704 Caps_synth Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae. Probab=10.83 E-value=1.7e+02 Score=13.67 Aligned_cols=36 Identities=19% Similarity=0.555 Sum_probs=0.0 Q ss_pred CCCHHHHHHHHHHHHHHHHHHCCHHHCCCCEECCCC Q ss_conf 700136779999999999850000100585112347 Q 537021.9.peg.9 12 NKSRMSTLHLFILIKVILFHSMTGYYIDNPLFCSEK 47 (48) Q Consensus 12 nksrmstlhlfilikvilfhsmtgyyidnplfcsek 47 (48) ++..++--|+-=+|.+-|...-.|..+|..+||+.. T Consensus 104 ~~~~i~~~~~SDilR~~LL~~yGG~W~DaTv~~T~~ 139 (279) T pfam05704 104 ESGKISRAHFSDILRLNLLAKYGGLWIDATIYCTGD 139 (279) T ss_pred HCCCCCHHHHHHHHHHHHHHHHCCEEEEEEEEECCC T ss_conf 749876478999999999998397887447887688 Done!