Query 537021.9.peg.97_1 Match_columns 55 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 23 18:43:20 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_97.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam09216 Pfg27 Pfg27. Members 34.9 43 0.0011 16.1 3.5 29 13-41 127-177 (186) 2 COG2307 Uncharacterized protei 25.8 30 0.00078 17.0 1.0 15 38-52 154-168 (313) 3 pfam11711 Tim54 Inner membrane 18.1 39 0.00099 16.4 0.3 16 31-46 290-305 (378) 4 pfam04168 DUF403 Bacterial dom 17.5 48 0.0012 15.9 0.6 27 26-52 138-170 (312) 5 KOG0862 consensus 16.6 1E+02 0.0025 14.1 3.9 26 20-45 189-215 (216) 6 pfam05917 DUF874 Helicobacter 14.6 57 0.0014 15.5 0.4 37 15-51 361-397 (417) 7 PRK12573 putative monovalent c 14.4 1.1E+02 0.0029 13.8 3.6 28 17-44 1-28 (140) 8 COG5595 Zn-ribbon-containing, 14.4 1.1E+02 0.0029 13.8 2.2 23 28-50 17-41 (256) 9 KOG3177 consensus 13.9 44 0.0011 16.1 -0.3 14 32-45 149-162 (227) 10 COG5543 Uncharacterized conser 12.9 1.3E+02 0.0032 13.5 4.7 40 8-47 961-1004(1400) No 1 >pfam09216 Pfg27 Pfg27. Members of this family are essential for gametocytogenesis in Plasmodium falciparum. They contain a fold composed of two pseudo dyad-related repeats of the helix-turn-helix motif, serving as a platform for RNA and Src homology-3 (SH3) binding. Probab=34.86 E-value=43 Score=16.12 Aligned_cols=29 Identities=48% Similarity=0.573 Sum_probs=19.6 Q ss_pred HHHHHHHHHHHH----------------------HHHHHHHHHHHHHHHHH Q ss_conf 973332104678----------------------69999999999999999 Q 537021.9.peg.9 13 ICKKREMNDLKL----------------------DIKAVVSVFFNILIDIW 41 (55) Q Consensus 13 ickkremndlkl----------------------dikavvsvffnilidiw 41 (55) --|||-|||++| +--+-+|-|.|-+.|-+ T Consensus 127 ~eKKrviNdl~lIk~y~e~~i~~n~~~~tddq~~~Aa~RiSnfvNDl~~~~ 177 (186) T pfam09216 127 KEKKRIMNDKKLIRMLFDTYEYVKDVKFTDDQYKDAAARISQFLNDVVDSY 177 (186) T ss_pred HHHHHHHCHHHHHHHHHHHHHHCCCEECCHHHCCHHHHHHHHHHHHHHHHH T ss_conf 789988530999999999997226702454332369999999999888876 No 2 >COG2307 Uncharacterized protein conserved in bacteria [Function unknown] Probab=25.76 E-value=30 Score=16.97 Aligned_cols=15 Identities=47% Similarity=1.041 Sum_probs=12.1 Q ss_pred HHHHHHHHHCCHHHH Q ss_conf 999999533013641 Q 537021.9.peg.9 38 IDIWRFLNIGKNIKK 52 (55) Q Consensus 38 idiwrflnigknikk 52 (55) -|.|||+.||+-|.. T Consensus 154 d~gwrFm~iGr~iER 168 (313) T COG2307 154 DDGWRFMRIGRRIER 168 (313) T ss_pred HHHHHHHHHHHHHHH T ss_conf 035789999999999 No 3 >pfam11711 Tim54 Inner membrane protein import complex subunit Tim54. Mitochondrial function depends on the import of hundreds of different proteins synthesized in the cytosol. Protein import is a multi-step pathway which includes the binding of precursor proteins to surface receptors, translocation of the precursor across one or both mitochondrial membranes, and folding and assembly of the imported protein inside the mitochondrion. Most precursor proteins carry amino-terminal targeting signals, called pre-sequences, and are imported into mitochondria via import complexes located in both the outer and the inner membrane (IM). The IM complex, TIM, is made up of at least two proteins which mediate translocation of proteins into the matrix by removing their signal peptide and another pair of proteins, Tim54 and Tim22, that insert the polytopic proteins, that carry internal targetting information, into the inner membrane. Probab=18.12 E-value=39 Score=16.38 Aligned_cols=16 Identities=38% Similarity=0.521 Sum_probs=12.9 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999999999533 Q 537021.9.peg.9 31 SVFFNILIDIWRFLNI 46 (55) Q Consensus 31 svffnilidiwrflni 46 (55) .-|+|+-+-|+||+|- T Consensus 290 lGFlntP~RiyRFfnr 305 (378) T pfam11711 290 LGFLNTPRRIYRFFNR 305 (378) T ss_pred CCCCCCCHHHHHHHHH T ss_conf 1334570999998888 No 4 >pfam04168 DUF403 Bacterial domain of unknown function (DUF403). Probab=17.54 E-value=48 Score=15.87 Aligned_cols=27 Identities=26% Similarity=0.692 Sum_probs=17.2 Q ss_pred HHHHHHHHHHHHH------HHHHHHHHCCHHHH Q ss_conf 9999999999999------99999533013641 Q 537021.9.peg.9 26 IKAVVSVFFNILI------DIWRFLNIGKNIKK 52 (55) Q Consensus 26 ikavvsvffnili------diwrflnigknikk 52 (55) +..-.+.|..+.. +.|+|+.+|+.|.. T Consensus 138 v~~~~~~~~G~~~~tM~R~~gw~Fl~lGr~iER 170 (312) T pfam04168 138 VKRRLALFRGLTHGTMLRDEGWRFLRLGRFLER 170 (312) T ss_pred HHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH T ss_conf 999999999888630411301199999899999 No 5 >KOG0862 consensus Probab=16.56 E-value=1e+02 Score=14.10 Aligned_cols=26 Identities=38% Similarity=0.438 Sum_probs=17.9 Q ss_pred HHHHHHHH-HHHHHHHHHHHHHHHHHH Q ss_conf 04678699-999999999999999953 Q 537021.9.peg.9 20 NDLKLDIK-AVVSVFFNILIDIWRFLN 45 (55) Q Consensus 20 ndlkldik-avvsvffnilidiwrfln 45 (55) |-.-+..+ |...+||.++...|||.- T Consensus 189 n~~sl~~~~aa~~~~~~~l~f~~~f~~ 215 (216) T KOG0862 189 NRKSLIRKYAAYVVFFVLLLFYVRFIA 215 (216) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 899999999999999999999999861 No 6 >pfam05917 DUF874 Helicobacter pylori protein of unknown function (DUF874). This family consists of several hypothetical proteins specific to Helicobacter pylori. The function of this family is unknown. Probab=14.57 E-value=57 Score=15.47 Aligned_cols=37 Identities=32% Similarity=0.335 Sum_probs=20.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH Q ss_conf 3332104678699999999999999999953301364 Q 537021.9.peg.9 15 KKREMNDLKLDIKAVVSVFFNILIDIWRFLNIGKNIK 51 (55) Q Consensus 15 kkremndlkldikavvsvffnilidiwrflnigknik 51 (55) |--||.|||.|-.|-.|.+-..|+----|-.|.|.|+ T Consensus 361 KMLEMR~lkp~pQAhL~~sQSllfvQkIfADvnKEI~ 397 (417) T pfam05917 361 KMLEMRDLKPDPQAHLPTSQSLLFVQKIFADVNKEIE 397 (417) T ss_pred HHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH T ss_conf 8998740688943458701669999999987767889 No 7 >PRK12573 putative monovalent cation/H+ antiporter subunit B; Reviewed Probab=14.43 E-value=1.1e+02 Score=13.78 Aligned_cols=28 Identities=39% Similarity=0.641 Sum_probs=16.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 3210467869999999999999999995 Q 537021.9.peg.9 17 REMNDLKLDIKAVVSVFFNILIDIWRFL 44 (55) Q Consensus 17 remndlkldikavvsvffnilidiwrfl 44 (55) |||||+-+..-+-+-..+-++..++-|+ T Consensus 1 r~m~slilr~~~r~l~p~ill~slyl~l 28 (140) T PRK12573 1 RKMNDLILRTVAKIVTFIILLFSVFLFL 28 (140) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9863059999999999999999999998 No 8 >COG5595 Zn-ribbon-containing, possibly nucleic-acid-binding protein [General function prediction only] Probab=14.36 E-value=1.1e+02 Score=13.76 Aligned_cols=23 Identities=43% Similarity=0.827 Sum_probs=15.3 Q ss_pred HHHHHHHHHHHHHHHHHH--HCCHH Q ss_conf 999999999999999953--30136 Q 537021.9.peg.9 28 AVVSVFFNILIDIWRFLN--IGKNI 50 (55) Q Consensus 28 avvsvffnilidiwrfln--igkni 50 (55) ..++-..|-|||-||+-. ||..| T Consensus 17 ~~~~~lln~lidqwryngqiigrei 41 (256) T COG5595 17 SAVDKLLNGLIDQWRYNGQIIGREI 41 (256) T ss_pred HHHHHHHHHHHHHHHHCCEEECCCC T ss_conf 5299999999998773677752425 No 9 >KOG3177 consensus Probab=13.94 E-value=44 Score=16.08 Aligned_cols=14 Identities=50% Similarity=0.918 Sum_probs=10.9 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 99999999999953 Q 537021.9.peg.9 32 VFFNILIDIWRFLN 45 (55) Q Consensus 32 vffnilidiwrfln 45 (55) -.||-||.+|+|-. T Consensus 149 rLF~~L~t~Wsf~p 162 (227) T KOG3177 149 RLFNHLITIWSFKP 162 (227) T ss_pred CHHHHHHHEEEECC T ss_conf 07776542244235 No 10 >COG5543 Uncharacterized conserved protein [Function unknown] Probab=12.95 E-value=1.3e+02 Score=13.53 Aligned_cols=40 Identities=20% Similarity=0.167 Sum_probs=32.4 Q ss_pred HHHHHHH-HHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHC Q ss_conf 8999997-333210467869999999999---999999995330 Q 537021.9.peg.9 8 SLLAIIC-KKREMNDLKLDIKAVVSVFFN---ILIDIWRFLNIG 47 (55) Q Consensus 8 sllaiic-kkremndlkldikavvsvffn---ilidiwrflnig 47 (55) ++|+-+. +.++|..--|.+.+++|-||. -+-.+|||+.+| T Consensus 961 ~~L~s~a~~qn~~hg~lL~~~~~ls~y~s~~l~~~~Vqri~ei~ 1004 (1400) T COG5543 961 ILLDSEAVEQNGMHGSLLENVYGLSSYSSEYLKHYTVQRICEIG 1004 (1400) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 98647888862458889999987878756442599999999987 Done!