BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.97_1 (55 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.97_1 Length = 55 Score = 109 bits (273), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 55/55 (100%), Positives = 55/55 (100%) Query: 1 LAACYHRSLLAIICKKREMNDLKLDIKAVVSVFFNILIDIWRFLNIGKNIKKLPI 55 LAACYHRSLLAIICKKREMNDLKLDIKAVVSVFFNILIDIWRFLNIGKNIKKLPI Sbjct: 1 LAACYHRSLLAIICKKREMNDLKLDIKAVVSVFFNILIDIWRFLNIGKNIKKLPI 55 >gi|254780474|ref|YP_003064887.1| ubiquinol oxidase, subunit II [Candidatus Liberibacter asiaticus str. psy62] Length = 332 Score = 23.5 bits (49), Expect = 0.70, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 29 VVSVFFNILIDIWRFLNIGKNIKKLP 54 VV VFF+IL W++ + K + P Sbjct: 61 VVPVFFSILFFAWKYRSTNKKARYDP 86 >gi|254780999|ref|YP_003065412.1| NAD synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 562 Score = 21.2 bits (43), Expect = 3.2, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 39 DIWRFLNIGKNIKK 52 DIW+ NI K++KK Sbjct: 152 DIWKNSNICKHLKK 165 >gi|254780662|ref|YP_003065075.1| NAD-glutamate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 1576 Score = 20.4 bits (41), Expect = 6.4, Method: Composition-based stats. Identities = 6/30 (20%), Positives = 16/30 (53%) Query: 24 LDIKAVVSVFFNILIDIWRFLNIGKNIKKL 53 +DI +++D+W +++G + +L Sbjct: 1459 IDISETCDTSLLVVLDMWSAISVGLGVDRL 1488 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.333 0.147 0.450 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,887 Number of Sequences: 1233 Number of extensions: 945 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 55 length of database: 328,796 effective HSP length: 27 effective length of query: 28 effective length of database: 295,505 effective search space: 8274140 effective search space used: 8274140 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 31 (16.5 bits)