BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.98_1 (37 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.98_1 Length = 37 Score = 75.9 bits (185), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 37/37 (100%), Positives = 37/37 (100%) Query: 1 MNNFNLTYLVQTKRLEKIMNDFFSGGSRITNNQFLTD 37 MNNFNLTYLVQTKRLEKIMNDFFSGGSRITNNQFLTD Sbjct: 1 MNNFNLTYLVQTKRLEKIMNDFFSGGSRITNNQFLTD 37 >gi|254780933|ref|YP_003065346.1| valyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 947 Score = 24.3 bits (51), Expect = 0.38, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 16/23 (69%) Query: 13 KRLEKIMNDFFSGGSRITNNQFL 35 K LEK++++ S ++ NNQF+ Sbjct: 890 KSLEKVLDELSSIKKKLENNQFV 912 >gi|254780222|ref|YP_003064635.1| DNA topoisomerase IV subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 686 Score = 20.8 bits (42), Expect = 4.7, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 17 KIMNDFFSGGSRITNNQFLTD 37 KI+N +G +I NNQ + D Sbjct: 495 KILNVASAGSEKIRNNQQIMD 515 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.136 0.383 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,364 Number of Sequences: 1233 Number of extensions: 474 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 37 length of database: 328,796 effective HSP length: 11 effective length of query: 26 effective length of database: 315,233 effective search space: 8196058 effective search space used: 8196058 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)