BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.993_1 (52 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.993_1 Length = 52 Score = 102 bits (255), Expect = 9e-25, Method: Compositional matrix adjust. Identities = 52/52 (100%), Positives = 52/52 (100%) Query: 1 MAYFFNQTKGKIIINDQLQLLMENIIKIRYVTQEARSLLGITLIKINRLATL 52 MAYFFNQTKGKIIINDQLQLLMENIIKIRYVTQEARSLLGITLIKINRLATL Sbjct: 1 MAYFFNQTKGKIIINDQLQLLMENIIKIRYVTQEARSLLGITLIKINRLATL 52 >gi|254780846|ref|YP_003065259.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 324 Score = 21.2 bits (43), Expect = 3.2, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 20 LLMENIIKIRYVTQEARSLLGIT 42 LL E + IR+ TQ+ S G+ Sbjct: 220 LLKEGVYAIRFRTQDQTSYSGVA 242 >gi|254780300|ref|YP_003064713.1| aspartate carbamoyltransferase catalytic subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 316 Score = 20.0 bits (40), Expect = 7.2, Method: Compositional matrix adjust. Identities = 12/44 (27%), Positives = 22/44 (50%) Query: 4 FFNQTKGKIIINDQLQLLMENIIKIRYVTQEARSLLGITLIKIN 47 FN + ++ Q+ L +E + + + A LLG+ +I IN Sbjct: 36 HFNPSTTRLQGLTQINLFLETSTRTQTSFEVAGKLLGVHVININ 79 >gi|254780612|ref|YP_003065025.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 503 Score = 19.6 bits (39), Expect = 9.7, Method: Composition-based stats. Identities = 6/8 (75%), Positives = 8/8 (100%) Query: 3 YFFNQTKG 10 YFFN+T+G Sbjct: 194 YFFNKTRG 201 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.143 0.375 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,653 Number of Sequences: 1233 Number of extensions: 660 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 52 length of database: 328,796 effective HSP length: 25 effective length of query: 27 effective length of database: 297,971 effective search space: 8045217 effective search space used: 8045217 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.3 bits) S2: 31 (16.5 bits)