d1b62a2d1i6pa_

Motif (click icon to enlarge)	SCOPid	Range	SCOP Class	SCOP Fold	SCOP Superfamily	SCOP Family	Protein
1b62_Ah	d1b62a2	A39-A50,A162-A216	Alpha and beta proteins (a+b)	ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase	ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase	DNA gyrase/MutL, N-terminal domain	DNA mismatch repair protein MutL
1i6p_Ac	d1i6pa_	A90-A137,A138-A215	Alpha and beta proteins (a/b)	Resolvase-like	beta-carbonic anhydrase, cab	beta-carbonic anhydrase, cab	beta-carbonic anhydrase

Justification for analogy
The motif in 1b62: compare d1b62a2 and d1amw__ (same superfamily), one strand and one helix is insertion. Hybrid motif. second helix too far away. The core of this fold looks like a circularly permuted ferredoxin. The motif uses one edge strand of the ferredoxin core and the C-terminal extensions.

In the alignments below, two upper-case letters are aligned, while two lower-case letters are NOT aligned. The two sequences in an alignment are NOT continuous in most cases (see their ranges). The superpositions are re-constructed from the corresponding alignments by minimizing the overall RMSD. In a PDB-format superposition file, the first domain is represented by chain S and the second domain is represented by chain A.

MANUAL alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1b62_Ah   ATRIDIDIERgg----------------------------------------rTEKTEFNHIDEIIRRIALAr---------fDVTINLSHN------GKIV-RQYRavpeggQKERRLGAIC---------
1i6p_Ac   VEHIIICGHYgcggvqaavenpelglinnwllhirdiwfkhssllgempqerrLDTLCELNVMEQVYNLGHStimqsawkrgqKVTIHGWAYgihdglLRDLdVTAT------NRETLEQRYRhgisnlklk

DALI alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1b62_Ah   ATRIDIDIER----------------------------------------ggRTEKTEFNHIDEIIRRIALA---------rfDVTINLSHN------GKIV-RQYRavpeggqkerRLGAIC-------------
1i6p_Ac   VEHIIICGHYgcggvqaavenpelglinnwllhirdiwfkhssllgempqerRLDTLCELNVMEQVYNLGHStimqsawkrgqKVTIHGWAYgihdglLRDLdVTAT----------NRETLEqryrhgisnlklk

TM alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1b62_Ah   --ATRIDIDIERGG--------R-----------------------------TEKTEFNHIDEIIRRIALARF----D-----------VTINLSH-N--GKIVRQYRAVPEGGQK-ERRLGAIC------
1i6p_Ac   VEHIIICGHY---GCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGHSTIMQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATN-R-ETLEQRYRHGISNLKLK

FAST alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1b62_Ah   ATRIDIDIERGGRTE------------------------------------------KTEFNHIDEIIRRIALARFD---------------VTINLSHNGKIV------------RQYRAVPEGGQK-ERRLGAIC----------
1i6p_Ac   VEHIIICGH------YGCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNL--GHSTIMQSAWKRGQKVTIHGWA-----YGIHDGLLRDLDVTATN-------RETLEQRY-RHGISNLKLK