d1b6ra1d1v97a4

Motif (click icon to enlarge)	SCOPid	Range	SCOP Class	SCOP Fold	SCOP Superfamily	SCOP Family	Protein
1b6r_Ai	d1b6ra1	A178-A196,A278-A287,A313-A355	All beta proteins	Barrel-sandwich hybrid	Rudiment single hybrid motif	BC C-terminal domain-like	N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain
1v97_Ac	d1v97a4	A415-A444,A445-A459,A460-A528	Alpha and beta proteins (a+b)	CO dehydrogenase flavoprotein C-domain-like	CO dehydrogenase flavoprotein C-terminal domain-like	CO dehydrogenase flavoprotein C-terminal domain-like	Xanthine oxidase, domain 4 (?)

Justification for analogy
The motif in 1b6r: motif occurs at the interface of the ATP-grasp fold and 'Barrel-sandwich hybrid' fold. The motif in 1v97: stand-along, core motif.

In the alignments below, two upper-case letters are aligned, while two lower-case letters are NOT aligned. The two sequences in an alignment are NOT continuous in most cases (see their ranges). The superpositions are re-constructed from the corresponding alignments by minimizing the overall RMSD. In a PDB-format superposition file, the first domain is represented by chain S and the second domain is represented by chain A.

MANUAL alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1b6r_Ai   -PLTHNLHQD-------gilRTSVAFP---------NPSVMINLigrKVGHLNLtds------------DTSRLTATLEALIPll-------PPEYASGVIWAQSKFG--------
1v97_Ac   dEFFSAFKQAsrreddiakvTCGMRVLfqpgsmqvkELALCYGGm--ADRTISAlkttqkqlskfwnekLLQDVCAGLAEELSlspdapggmIEFRRTLTLSFFFKFYltvlkklg

DALI alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1b6r_Ai   -PLTHNLHQD-------GILRTSVAFP---------NPSVMINLigrKVGHLNL---TDSD---------TSRLTATLEALIPL-------lPPEY-ASGVIWAQSKFG-------
1v97_Ac   dEFFSAFKQAsrreddiAKVTCGMRVLfqpgsmqvkELALCYGG--mADRTISAlktTQKQlskfwneklLQDVCAGLAEELSLspdapggmIEFRrTLTLSFFFKFYLtvlkklg

TM alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1b6r_Ai   PLTHNLHQD------------GILRTSVAFP-N-PS-VMINLI--G---RKVGH--LN-L-TDSDTSRLTATLEALIPL-L----------------------PPEYASGVIWAQS-KFG
1v97_Ac   -DEFFSAFKQASRREDDIAKVTCGMRVLFQPGSMQVKELALCYGGMADRTISALKTTQKQLSK--F--WNEKLLQDVCAGLAEELSLSPDAPGGMIEFRRTLTLSFFFKFYLTVLKKL-G

FAST alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1b6r_Ai   -PLTHNLHQDGILR------------TSVAFPN----------PSVMINLIGRKV----GHLNLTDSDT------------SRLTATLEA-LIPLLP---------------PEYASGVIWAQSKFG----
1v97_Ac   DEFFSAFKQ-----ASRREDDIAKVTCGMRVL-FQPGSMQVKELALCYG------GMADRTISAL----KTTQKQLSKFWNEKLLQDVCAGLAEEL-SLSPDAPGGMIEFRRTLTLSFFFKFYLTVLKKLG