d1ecfa2d1unnc_

Motif (click icon to enlarge)	SCOPid	Range	SCOP Class	SCOP Fold	SCOP Superfamily	SCOP Family	Protein
1ecf_Ah	d1ecfa2	A1-A75	Alpha and beta proteins (a+b)	Ntn hydrolase-like	N-terminal nucleophile aminohydrolases (Ntn hydrolases)	Class II glutamine amidotransferases	Glutamine PRPP amidotransferase, N-terminal domain
1unn_Cc	d1unnc_	C241-C351	Alpha and beta proteins (a+b)	Lesion bypass DNA polymerase (Y-family), little finger domain	Lesion bypass DNA polymerase (Y-family), little finger domain	Lesion bypass DNA polymerase (Y-family), little finger domain	DNA polymerase IV

Justification for analogy
The motif in 1ecf: compare d1ecfa2 (Class II glutamine amidotransferases) and d1pmab_ (Proteasome subunits), superimpose the two first strands, and it seems that at least two strands in the reverse-ferredoxin motif in d1ecfa2 are insertions. hybrid motif. The bottom line is that Ntn and reverse-ferredoxin are drastically different folds. So the reverse_ferredoxin motif in Ntn is analog to real reverse_ferredoxin domains.

In the alignments below, two upper-case letters are aligned, while two lower-case letters are NOT aligned. The two sequences in an alignment are NOT continuous in most cases (see their ranges). The superpositions are re-constructed from the corresponding alignments by minimizing the overall RMSD. In a PDB-format superposition file, the first domain is represented by chain S and the second domain is represented by chain A.

MANUAL alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1ecf_Ah   -CGIVGIAGVM-----PVNQSIYDALTVLQHRG---------QDAAGIITIDANNCFRLRKANG---LVSDVF--EARHMQRLQ----GNMGIGHVRYP------------
1unn_Cc   hHVGVERTMAEdihhwSECEAIIERLYPELERRlakvkpdllIARQGVKLKFDDFQQTTQEHVWprlNKADLIatARKTWDERRggrgVRLVGLHVTLLdpqmerqlvlgl

DALI alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1ecf_Ah   -CGIVGIAGV---------mpVNQSIYDALTVLQH-----rgQDAAGIITIDANNCFRLRKA-NGLVS-dVFEArHMQR-------lqGNMGIGHVRYP------------
1unn_Cc   hHVGVERTMAedihhwseceaIIERLYPELERRLAkvkpdllIARQGVKLKFDDFQQTTQEHvWPRLNkaDLIAtARKTwderrggrgVRLVGLHVTLLdpqmerqlvlgl

TM alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1ecf_Ah   -CGIVGIAGV-MP----VNQ-SIYD-ALTV--LQHR------GQD-AAGIITIDANNCFRLRKANG--LV-SDV--FEARHMQ-RL---QGNMGIGHVRYP------------
1unn_Cc   HHVGVERTMAEDIHHWSECEAI-IERLY-PELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDPQMERQLVLGL

FAST alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1ecf_Ah   -CGIVGIAGVMP----------VNQSIYDALTVLQHRGQ---------DAAGIITIDANNCFRLRKANGLV----SDVFEARHMQRLQG----------NMGIGHVRYP------------
1unn_Cc   HHVGVERTMAE-DIHHWSECEAIIERLYPELERRL----AKVKPDLLIARQGVKLKFDDFQQTTQEHVW--PRLNKADL-IATARKT--WDERRGGRGVRLVGLHVTLLDPQMERQLVLGL