d1ihoa_d1ep7a_

Motif (click icon to enlarge)	SCOPid	Range	SCOP Class	SCOP Fold	SCOP Superfamily	SCOP Family	Protein
1iho_Ah	d1ihoa_	A1-A23,A49-A57,A71-A95	Alpha and beta proteins (a/b)	Adenine nucleotide alpha hydrolase-like	Nucleotidylyl transferase	Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC)	Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC)
1ep7_Ah	d1ep7a_	A1-A24,A25-A35,A36-A112	Alpha and beta proteins (a/b)	Thioredoxin fold	Thioredoxin-like	Thioltransferase	Thioredoxin

Justification for analogy
The motif in 1iho: comparing d1ihoa_ with d1coza_ (different family same superfamily, note the split between the first and the fourth strands). The insertion is one strand and one helix, which is absent in d1coza_. The motif in 1ep7: one strand and one helix are N-terminal extension to the thioredoxin fold. hybrid motif.

In the alignments below, two upper-case letters are aligned, while two lower-case letters are NOT aligned. The two sequences in an alignment are NOT continuous in most cases (see their ranges). The superpositions are re-constructed from the corresponding alignments by minimizing the overall RMSD. In a PDB-format superposition file, the first domain is represented by chain S and the second domain is represented by chain A.

MANUAL alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1iho_Ah   -mLIIET--LPLLRQQIRRLRMEGkrdVVVVSIFV------yprTLQEDCEKLNKRKv-dLVFAPSV------------------------------------------------
1ep7_Ah   ggSVIVIdsKAAWDAQLAKGKEEH---KPIVVDFTatwcgpckmIAPLFETLSNDYAgkvIFLKVDVdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa

DALI alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1iho_Ah   ---MLIIETLPLLRQQIRRLRMEGKrDVVVVSIFVypRTLQEDCEKLNKRK-------vDLVFAPSV----------------------------------------------
1ep7_Ah   ggsVIVIDSKAAWDAQLAKGKEEHK-PIVVDFTATwcGPCKMIAPLFETLSndyagkviFLKVDVDAvaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa

TM alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1iho_Ah   ---MLIIETLPLLRQQIRRLRMEGKRDVVVVSIFVYPRTL-QED-CEK-LNKRK-------VDLVFAP-S-V--------------------------------------------
1ep7_Ah   GGSVIVIDSKAAWDAQLAKGKEEHKP-IVVDFTA--TWCGP-CKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA

FAST alignment     PDB format superposition    aligned motifs in PyMol   whole structures in PyMol

1iho_Ah   ---MLIIETLPLLRQQIRRLRMEGKRDVVVVSIFVYPR---------TLQEDCEKLNKRKVD----LVFAPSV------------------------------------------------
1ep7_Ah   GGSVIVIDSKAAWDAQLAKGKEEH---KPIVVDFT---ATWCGPCKMIAPLFETLSNDY---AGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA