P47973 | TIS11; Zfp36

P47973 | Tristetraprolin proviz swissmodel

Reference DB: NESdb:36 validNES:P027
Species: Rattus norvegicus (Rat)
Evidence: LMB Sensitive
Mutation(export): 1MDLSAIYESLMSMSH15 by Deletion, L3A/I6A/L10A
Mutation(bind): Unknown
Functional seq: 1MDLSAIYESLMSMSHDLSPDHGGTESSGGLWNINSSDSIPSGVTSRLTGRSTSLVEGRSCSWVPPPPGFAPLAPRPGPELSPSPTSPTATPTTSSRYKTEL101
Sites: 1-101

*Experimental: mutation (blue); functional region (cyan); located in the long functional sequence (lightblue)
*NES patterns: region with experimental evidence (red-orange-yellow); false positive region (gray)

#	candidates	id	start#	sequence	secondary	class	multi-pattern	diso	spotd	iup	loc_DISO	loc_CDD
1	cand_D	P47973	1	XXMDLSAIYESLMSMS ++++++++++*	CCHHHHHHHHHCCCCC	c1aR-5-Nt	multi-selected	0.939	0.927	0.451	DISO
2	cand_D	P47973	2	DLSAIYESLMSMSH ..........	CHHHHHHHHHCCCC	c3-4	multi-selected	0.939	0.926	0.449	DISO
3	fp_D	P47973	154	RCHFIHNPTEDLALPG	CCCCCCCCCCCCCCCC	c1a-AT-4	uniq	0.177	0.703	0.459	DISO	boundary\|zf-CCCH superfamily;
4	fp_D	P47973	306	PPRRLPIFNRISVSE	CCCCCCCCCCCCCCC	c1b-4	multi	0.234	0.552	0.58	DISO
5	fp_D	P47973	309	RLPIFNRISVSE	CCCCCCCCCCCC	c2-rev	multi-selected	0.204	0.521	0.56	DISO

*candidates: NES candidates and false positives annotated with "cand" and "fp", respectively;
                if the segment is located in the disordered or boundary region, flagged with "D"; if the segment is located in the ordered region, flagged with "O";
                if the segment's beta-strand content is over 0.5, flagged with "beta".
*sequence: Hydrophobic positions are colored in red. The positions with the experimental evidence is marked with '*' (mutation) and '+' (functional sequence in NESdb or sites in validNES).
                The positions with '.' are for the region annotated in the long (more than 25 residues) functional sequence or site.
*multi-pattern: the consensus pattern is unique or multiple within the region (if the start# difference is less than 5, the segments are considered to be the same region)
*diso: average DISOPRED3-predicted disorder propensity for the segment
*spotd: average SPOT-Disorder-predicted disorder propensity for the segment
*iup: average IUPRED2A-predicted disorder propensity for the segment
*loc_DISO: location of the segment with respect to the ordered/disordered regions
*loc_CDD: location of the segment with respect to the conserved region annotated in the Conserved Domain Database (CDD)
*beta: beta-strand content in the middle of the segment