Q8N720 | VIK-1; ZNF655

Q8N720 | Zinc finger protein 655 proviz swissmodel

Reference DB: NESdb:207 validNES:P114
Species: Homo sapiens (Human)
Evidence: LMB Sensitive
Mutation(export): 95RLERLQEILRKFLYL109 by Deletion
Mutation(bind): Unknown
Functional seq: 1MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGDGETREENKLLIPKQKISEEVHSYKVRVGRLKHDITQVPETREVYKSEDRLERLQEILRKFLYLEREFRQITISKETFTSEKNNECHEPEKSFSLDSTIDADQRVLRIQNTDDNDKYDMSFNQNSASGKHEHLNLTEDFQSSECKESLMDLSHLNKWESIPNTEKSYKCDVCGKIFHQSSALTRHQRIHTREKPYKCKECEKSFSQSSSL255
Sites: 95-109

*Experimental: mutation (blue); functional region (cyan); located in the long functional sequence (lightblue)
*NES patterns: region with experimental evidence (red-orange-yellow); false positive region (gray)

#	candidates	id	start#	sequence	secondary	class	multi-pattern	diso	spotd	iup	loc_DISO
1	fp_D	Q8N720	72	RVGRLKHDITQVPE ..............	EECCCCCCCCCCCC	c3-4	uniq	0.074	0.952	0.481	DISO
2	cand_D	Q8N720	95	RLERLQEILRKFLYLER +++++++++++++..	CCCCHHHHHHCCCCCCC	c1c-5	multi-selected	0.085	0.832	0.243	DISO
3	cand_D	Q8N720	95	RLERLQEILRKFLY *+++++++++++++	CCCCHHHHHHCCCC	c3-4	multi-selected	0.081	0.828	0.256	DISO
4	cand_D	Q8N720	98	RLQEILRKFLYLER +++++++++++*..	CHHHHHHCCCCCCC	c3-4	multi-selected	0.089	0.816	0.215	DISO
5	fp_D	Q8N720	105	KFLYLEREFRQITISK ++++*...........	CCCCCCCCCCCHHHHC	c1a-5	uniq	0.158	0.852	0.252	DISO

*candidates: NES candidates and false positives annotated with "cand" and "fp", respectively;
                if the segment is located in the disordered or boundary region, flagged with "D"; if the segment is located in the ordered region, flagged with "O";
                if the segment's beta-strand content is over 0.5, flagged with "beta".
*sequence: Hydrophobic positions are colored in red. The positions with the experimental evidence is marked with '*' (mutation) and '+' (functional sequence in NESdb or sites in validNES).
                The positions with '.' are for the region annotated in the long (more than 25 residues) functional sequence or site.
*multi-pattern: the consensus pattern is unique or multiple within the region (if the start# difference is less than 5, the segments are considered to be the same region)
*diso: average DISOPRED3-predicted disorder propensity for the segment
*spotd: average SPOT-Disorder-predicted disorder propensity for the segment
*iup: average IUPRED2A-predicted disorder propensity for the segment
*loc_DISO: location of the segment with respect to the ordered/disordered regions
*loc_CDD: location of the segment with respect to the conserved region annotated in the Conserved Domain Database (CDD)
*beta: beta-strand content in the middle of the segment