Protein Domain ID: d1xdna_
Superfamily ID: d.142.2
Number of Sequences: 8
Sequence Length: 265
Structurally conserved residues: 127
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261
| | | | | | | | | | | | | | | | | | | | | | | | | | |
557**********8778***8633537******************888633377**********53222336777766778875555555531111222378*********8883322333322333311222555323333221122237***********863222368**8*************5******78777777*****887*8886632222111112223**********873323333538******7722221
d1xdna_: QSDFSPYIEIDLPSESRIQSLHKSGLAAQEWVACEKVHGTNFGIYLINQGDHEVVRFAKRSGIMDPNENFFGYHILIDEFTAQIRILNDLLKQKYGLSRVGRLVLNGELFGAKYKHPLVPKSEKWCTLPNGKKFPIAGVQIQREPFPQYSPELHFFAFDIKYSVSGAEEDFVLLGYDEFVEFSSKVPNLLYARALVRGTLDECLAFDVENFMTPLPALLGLGNYPLEGNLAEGVVIRHVRRGDPAVEKHNVS