Protein Domain ID: d2hdsa1
Superfamily ID: e.3.1
Number of Sequences: 30
Sequence Length: 358
Structurally conserved residues: 168
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321 331 341 351
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
345567777899998766777748*******99******4311112333355**********************9644689987655223333223554558999656644443322222212221233333224444233355589*9**********85443679999**9499888887799**22101111111111111223334456676566***************9*9345453568889*****522222222222289984455533222101111000000000000000000089*******888********998********89489999*******9***98
d2hdsa1: APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQL