A0A075B6H9 LV469_HUMAN
Gene name: IGLV4-69
Protein name: Immunoglobulin lambda variable 4-69
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A0A075B6J9 | IGLV2-18 | 0.90286 | |
| 2 | Q9BZY9 | TRIM31 | 0.67674 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q0IIM8 | TBC1D8B | 0.67028 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 4 | P13747 | HLA-E | 0.66791 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 ... |
| 5 | Q9H3M0 | KCNF1 | 0.65595 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 transmembrane transport GO:0055085 ... |
| 6 | Q9UBF6 | RNF7 | 0.63246 | catabolic process GO:0009056 cellular protein modification process GO:0006464 |
| 7 | Q6DCA0 | AMMECR1L | 0.61541 | |
| 8 | Q8NEZ2 | VPS37A | 0.6153 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 9 | Q13474 | DRP2 | 0.60109 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cell-cell signaling GO:0007267 |
| 10 | Q9H2H0 | CXXC4 | 0.58919 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 embryo development GO:0009790 ... |
20 40 60 80 100 AA: MAWTPLLFLTLLLHCTGSLSQLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTIS STMI: SSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: ......................................................D..........DDDDDD......DDDDDDDD............... DO_SPOTD: .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... CONSENSUS: ................................................................................ CONSENSUS_MOBI: ....................................................DDDDDDDDDDDDDDDDDDDD........ RICH_MOBI_[GS]: GShSkGdGipdrfSGSSSG
AA: SLQSEDEADYYCQTWGTGI STMI: DO_DISOPRED3: ................... DO_IUPRED2A: ................... DO_SPOTD: ................... CONSENSUS: ................... CONSENSUS_MOBI: ...................