A0A087WWA1 P3URF_HUMAN

Gene name: P3R3URF
Protein name: PIK3R3 upstream open reading frame protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96NS8 CLUHP3 0.8355
2 Q9NTK1 DEPP1 0.69141 catabolic process GO:0009056
3 Q8NFW8 CMAS 0.68687 cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
4 A8MQB3 LINC02693 0.6567
5 Q96S06 LMF1 0.64045 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
protein maturation GO:0051604
...
6 Q9HCX4 TRPC7 0.62852 homeostatic process GO:0042592
reproduction GO:0000003
response to stress GO:0006950
...
7 Q86YD1 PTOV1 0.62667 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 Q9H8S5 CCNP 0.62149 cell cycle GO:0007049
cellular protein modification process GO:0006464
mitotic cell cycle GO:0000278
9 P59051 BRWD1-AS2 0.61778
10 Q15768 EFNB3 0.61727 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...

                                           20                  40                  60                  80     
AA:                      MGPSRLVRGPRPQGMRSPYRRPGMGWPRPRFPRMFKCSRRRYQQGLRGRTASSAAINPATRAMGINNTHTDTTIVWIFPPQVLRHLRQPGIFLIL
STMI:                                                                                                                   
DO_DISOPRED3:            DDDDDDDDDDDDDD.................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDD.D...DD.....DDDD.DDDDDDDDDDDDDDDDDDDDDDDD..............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................
RICH_[PR]:                 PsRlvRgPRPqgmRsPyRRPgmgwPRPR                                                                 
RICH_[AI]:                                                                 AssAAInpAtrAmgI                              
RICH_[AR]:                                                      RRyqqglRgRtAssAAinpA                                    
RICH_[A]:                                                                  AssAAinpAtrA                                 
RICH_[P]:                         PrPqgmrsPyrrPgmgwPrP                                                                  
RICH_[R]:                    RlvRgpRpqgmRspyRRpgmgwpRpR        RRRyqqglRgR                                              
RICH_[GP]:                       GPrPqGmrsPyrrPGmGwP                                                                    
RICH_[GR]:                      RGpRpqGmRspyRRpGmGwpR                                                                   
RICH_[MR]:                             MRspyRRpgM                                                                       
RICH_fLPS_[R]:            gpsRlvRgpRpqgmRspyRR                                                                          
RICH_MOBI_[M]:                         MrspyrrpgM                                                                       
RICH_MOBI_[R]:               RlvRgpRpqgmRspyRR                                                                          
RICH_MOBI_[GM]:                  GprpqGMrspyrrpGMG                                                                      
RICH_MOBI_[GR]:                 RGpRpqGmRspyRRpGmG                                                                      
RICH_MOBI_[MR]:          MgpsRlvRgpRpqgMRspyRRpgM