Q96NS8 CLUP3_HUMAN
Gene name: CLUHP3
Protein name: Putative protein CLUHP3
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A0A087WWA1 | P3R3URF | 0.8355 | |
| 2 | O95922 | TTLL1 | 0.75229 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 3 | A8MQB3 | LINC02693 | 0.74884 | |
| 4 | P28062 | PSMB8 | 0.73864 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 5 | A1L168 | C20orf202 | 0.73779 | |
| 6 | Q8N142 | ADSS1 | 0.71819 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 7 | Q99832 | CCT7 | 0.70509 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 8 | Q8TCG5 | CPT1C | 0.67913 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 9 | Q96PD7 | DGAT2 | 0.67574 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 10 | O43323 | DHH | 0.67403 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MFLNGNCLETLKKKEPEGGRRRLSHPGNMGWMRPSQETTPPDRSHHSGFGLFCGDPGPEIEPFSLWVFPQEMVLEIHQLFMDHEYPCHHITSHCTWVAAH STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. DO_IUPRED2A: .............DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... CONSENSUS_MOBI: .............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................... RICH_[R]: RRRlshpgnmgwmR RICH_[GR]: GGRRRlshpGnmGwmR RICH_MOBI_[R]: RRRlshpgnmgwmR RICH_MOBI_[GM]: GGrrrlshpGnMGwM RICH_MOBI_[GR]: GGRRRlshpGnmGwmR RICH_MOBI_[MR]: RRRlshpgnMgwMR
120 140 AA: WTTSQSCAAWQGCRRACCSTWWKSPAQCTRPTVMSATFETAQEPGPS STMI: DO_DISOPRED3: ...................................DDDDDDDDDDDD DO_IUPRED2A: ..................................DDD.DDDDDDDDD DO_SPOTD: .......................................DDDDDDDD CONSENSUS: ...................................DDDDDDDDDDDD CONSENSUS_MOBI: ...............................................