A0A183 LCE6A_HUMAN

Gene name: LCE6A
Protein name: Late cornified envelope protein 6A

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O75829 CNMD 0.74137 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
2 P14598 NCF1 0.70201 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
3 Q96T54 KCNK17 0.68004 transmembrane transport GO:0055085
transport GO:0006810
4 Q9H2D6 TRIOBP 0.67845 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell cycle GO:0007049
...
5 Q3SY00 TSGA10IP 0.67805
6 Q96IR3 n/a 0.67674
7 Q96L11 LLCFC1 0.67674
8 P11487 FGF3 0.67563 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell division GO:0051301
...
9 Q14CB8 ARHGAP19 0.67447 signal transduction GO:0007165
10 Q13322 GRB10 0.67248 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...

                                           20                  40                  60                  80                    
AA:                      MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD
STMI:                                                                                                    
DO_DISOPRED3:            DDDDDDDDDDDDD.D.............................D.DDDDDDDDDDDDDDD..................D
DO_IUPRED2A:             DDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDD...................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDD..................D
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDD.............DDDDDDDDDDDDDDDDDDDDDDDDDD....................
RICH_[R]:                                                               RpevqkpRRaR                      
RICH_MOBI_[P]:                     PPnvPkcsPP                                                            
RICH_MOBI_[Q]:             QQkQQswkppnvpkcsppQ                                                           
RICH_MOBI_[R]:                                                          RpevqkpRRaR