A0A1B0GTI8 TM272_HUMAN
Gene name: TMEM272
Protein name: Transmembrane protein 272
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6NUI2 | GPAT2 | 0.83205 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 2 | Q8N1C3 | GABRG1 | 0.83205 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 3 | Q9NUN5 | LMBRD1 | 0.75569 | biological process involved in symbiotic interaction GO:0044403 small molecule metabolic process GO:0044281 |
| 4 | Q92882 | OSTF1 | 0.7361 | immune system process GO:0002376 signal transduction GO:0007165 transport GO:0006810 ... |
| 5 | P62495 | ETF1 | 0.73106 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q8NE00 | TMEM104 | 0.7175 | |
| 7 | Q9Y6J8 | STYXL1 | 0.70711 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 8 | Q8N485 | LIX1 | 0.70711 | catabolic process GO:0009056 |
| 9 | P29972 | AQP1 | 0.68662 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 10 | Q6NVV0 | MKRN9P | 0.66227 |
20 40 60 80 100 AA: MVSLLLYDSTRMRRLLSKAVVIDDDDDDEYPWRQNAHRYYIHLLLSLFLFLWFILGNYWVFSVYLPDFLPPFQQPQDYCDKTLYLFAVGVLALSHTVLVL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMM DO_DISOPRED3: .....D........DDDDDDDDDDDDDDDDDD.................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDD.DDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: .....D........DDDDDDDDDDDDDDDDD......... ..................... CONSENSUS_MOBI: ........................................ ..................... RICH_fLPS_[D]: llskavviDDDDDDe
120 AA: LLLCSGCVYLCSRWRLAADED STMI: MMM DO_DISOPRED3: ...................DD DO_IUPRED2A: ..................... DO_SPOTD: ................DDDDD CONSENSUS: ................DD CONSENSUS_MOBI: ..................