P29972 AQP1_HUMAN
Gene name: AQP1
Protein name: Aquaporin-1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biological process involved in symbiotic interaction GO:0044403
- cell death GO:0008219
- cell population proliferation GO:0008283
- cytoskeleton organization GO:0007010
- homeostatic process GO:0042592
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q92882 | OSTF1 | 0.84435 | immune system process GO:0002376 signal transduction GO:0007165 transport GO:0006810 ... |
| 2 | Q9Y2U9 | KLHDC2 | 0.72701 | |
| 3 | Q13618 | CUL3 | 0.72701 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 4 | P35813 | PPM1A | 0.70701 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell-cell signaling GO:0007267 ... |
| 5 | Q9BXN1 | ASPN | 0.70269 | anatomical structure development GO:0048856 signal transduction GO:0007165 |
| 6 | Q6PGQ1 | DRICH1 | 0.70113 | |
| 7 | Q969E8 | TSR2 | 0.69579 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 8 | Q9Y6X5 | ENPP4 | 0.68662 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 9 | Q9HD40 | SEPSECS | 0.67211 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 ... |
| 10 | Q8TDP1 | RNASEH2C | 0.6705 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 nucleobase-containing compound catabolic process GO:0034655 |
20 40 60 80 100 AA: MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIA STMI: MMMMMMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMM IIIIIIIIIIIIII MMMMMM DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: .........................................D.......................................................... CONSENSUS: ....... ............ .... .......... CONSENSUS_MOBI: DD..... ............ .... ..........
120 140 160 180 200 AA: QCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSA STMI: MMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMM IIIIIIIIIIIIII DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ..................... ........... ... CONSENSUS_MOBI: ..................... ........... ...
220 240 260 AA: VITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...................................................DDDDDDDDDDDDDDDDDD DO_IUPRED2A: ..................................................................... DO_SPOTD: ...............................................DDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ....... .......................DDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....... .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_fLPS_[D]: eyDlDaDDin RICH_MOBI_[D]: DltDrvkvwtsgqveeyDlD