A0A1B0GUV7 TEX48_HUMAN

Gene name: TEX48
Protein name: Testis-expressed protein 48

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IWF2 FOXRED2 0.65038 catabolic process GO:0009056
response to stress GO:0006950
2 P0DN78 OPN1MW3 0.64519 cellular protein modification process GO:0006464
nervous system process GO:0050877
signal transduction GO:0007165
3 O75460 ERN1 0.6366 catabolic process GO:0009056
cell cycle GO:0007049
cell death GO:0008219
...
4 O60906 SMPD2 0.62366 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
5 Q86VF7 NRAP 0.61803 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
6 Q9UIG5 PSORS1C1 0.61603
7 Q8N7X4 MAGEB6 0.61272
8 Q9NZC9 SMARCAL1 0.59824 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
9 P41180 CASR 0.594 anatomical structure development GO:0048856
cell death GO:0008219
cell population proliferation GO:0008283
...
10 P08047 SP1 0.58111 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...

                                           20                  40                  60                  80                 100
AA:                      MAAHQNLILKIFCLCCRDCQEPYAINDSKVPSQTQEHKPSTQNLLLQKDELDRQNPKRINAVSHLPSRTPLIQTKKSTSSSSSEFEDLNAYASQRNFYKR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDD...........................................................................DDDDDDD..............
DO_IUPRED2A:             ..........................DDDDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDD..DDDD..............
DO_SPOTD:                DDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
CONSENSUS:               DDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............
CONSENSUS_MOBI:          ............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............
RICH_[Q]:                                                QtQehkpstQnlllQ                                                     
RICH_[S]:                                                                              ShlpSrtpliqtkkStSSSSS                 
RICH_[LQ]:                                               QtQehkpstQnLLLQkdeL                                                 
RICH_fLPS_[S]:                                                                                    tkkStSSSSS                 
RICH_MOBI_[Q]:                                           QtQehkpstQnlllQ                                                     
RICH_MOBI_[LQ]:                                          QtQehkpstQnLLLQkdeL                                                 
RICH_fLPS_MOBI_[S]:                                                                               tkkStSSSSS