Q9UIG5 PS1C1_HUMAN

Gene name: PSORS1C1
Protein name: Psoriasis susceptibility 1 candidate gene 1 protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q86UQ8 NFE4 0.87666 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
2 O60906 SMPD2 0.7913 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
3 Q8IWF2 FOXRED2 0.74819 catabolic process GO:0009056
response to stress GO:0006950
4 P14859 POU2F1 0.71574 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...
5 O95813 CER1 0.70685 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
6 Q86VF7 NRAP 0.68523 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
7 Q9H410 DSN1 0.67956 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
8 P01133 EGF 0.6221 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
9 P08047 SP1 0.61956 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
10 P16860 NPPB 0.61894 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHMEPANHFWHAGDLQAMISKEFHLAATQDDCRKGRTQEDILVPSSHPELFASV
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD...............D.DDDDD.............................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD....D........D.D..DDDDDDD.DDDDDDDDDDDDDD.D.DDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................
RICH_[Q]:                     QkshsQralgtQtpalQgpQ                                                                           
RICH_[T]:                 TcTdqkshsqralgTqT                                                                                  
RICH_[LQ]:                         QraLgtQtpaLQgpQLL                                                                         
RICH_MOBI_[L]:                        LgtqtpaLqgpqLL                                                                         
RICH_MOBI_[Q]:                QkshsQralgtQtpalQgpQ                                                                           
RICH_MOBI_[T]:            TcTdqkshsqralgTqT                                                                                  
RICH_MOBI_[LQ]:                    QraLgtQtpaLQgpQLL                                                                         

                                          120                 140        
AA:                      LPMAPEEAARLQQPQPLPPPSGIHLSASRTLAPTLLYSSPPSHSPFGLSSLI
STMI:                                                                        
DO_DISOPRED3:            ....................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDD.......DD.................
DO_SPOTD:                ......DDDDDDDDDD............DDDD.........DDDDDDDDDDD
CONSENSUS:               ......DDDDDDDDDD....................................
CONSENSUS_MOBI:          ....................................................