A0A1B0GVM5 ETDC_HUMAN
Gene name: ETDC
Protein name: Embryonic testis differentiation protein homolog C
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q3ZM63 | ETDA | 0.99998 | |
| 2 | Q6ZNX1 | SHLD3 | 0.99994 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 3 | A0AVF1 | TTC26 | 0.99975 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 4 | Q96P63 | SERPINB12 | 0.99975 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 5 | Q8WV22 | NSMCE1 | 0.99968 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 ... |
| 6 | Q5JX71 | FAM209A | 0.99816 | |
| 7 | O95057 | DIRAS1 | 0.99756 | signal transduction GO:0007165 |
| 8 | Q9HAN9 | NMNAT1 | 0.99098 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 9 | Q4W5G0 | TIGD2 | 0.98513 | |
| 10 | Q9H3H1 | TRIT1 | 0.97075 | cellular nitrogen compound metabolic process GO:0034641 |
20 40 AA: MDKELPKASPSEPALNIKKSGKSFKCKKPTKNVQVFLINRQLGRNRSDTDLSKWLWMLP STMI: DO_DISOPRED3: DDDDDDDDDDD.D.............................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDD............DDD.................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD.D.D................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD.................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD..................................... RICH_[K]: KelpKaspsepalniKKsgK RICH_MOBI_[K]: KelpKaspsepalniKKsgK