Q6ZNX1 SHLD3_HUMAN
Gene name: SHLD3
Protein name: Shieldin complex subunit 3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- immune system process GO:0002376
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q3ZM63 | ETDA | 0.99999 | |
2 | A0A1B0GVM5 | ETDC | 0.99994 | |
3 | Q8WV22 | NSMCE1 | 0.9999 |
cellular nitrogen compound metabolic process
GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 ... |
4 | A0AVF1 | TTC26 | 0.99944 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
5 | Q96P63 | SERPINB12 | 0.99944 |
anatomical structure development
GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
6 | Q5JX71 | FAM209A | 0.99741 | |
7 | O95057 | DIRAS1 | 0.99671 |
signal transduction
GO:0007165 |
8 | Q9HAN9 | NMNAT1 | 0.99244 |
biosynthetic process
GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
9 | Q4W5G0 | TIGD2 | 0.98702 | |
10 | Q9H3H1 | TRIT1 | 0.97342 |
cellular nitrogen compound metabolic process
GO:0034641 |
20 40 60 80 100
AA: MTTEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEHDAKSHSYDCTVDLLEFQPSLKKQ
STMI:
DO_DISOPRED3: D...................................................................................................
DO_IUPRED2A: .................DDDDDDDDDD........................DDDDDDDDDDDD.......DD............................
DO_SPOTD: ...............................................................................................DDDDD
CONSENSUS: ....................................................................................................
CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200
AA: HLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCTKNVSPLSKKLQDSLKALNLHSLYRARWTIEHTICNSQTLEDIWTKLNQIIRHNELPSC
STMI:
DO_DISOPRED3: ..........DDDDDDDDDDDD..............................................................................
DO_IUPRED2A: ...DDD.DDDDDDDDDDDDDDDDDD..DDD......................................................................
DO_SPOTD: DDD..DDDDDDDDDDDDDDDDDDDDD..........................................................................
CONSENSUS: .....DDDDDDDDDDDDDDDDDDDD...........................................................................
CONSENSUS_MOBI: .......DDDDDDDDDDDDDDDDDDDDDD.......................................................................
RICH_[K]: KeqtnsgnlgKqseKgK
RICH_MOBI_[K]: KeqtnsgnlgKqseKgKqhK
220 240
AA: NATIQRHLGQIWVFCDIMYCEYVGSLLKGRLALTGKINLFVHKYGVIFSM
STMI:
DO_DISOPRED3: ..................................................
DO_IUPRED2A: ..................................................
DO_SPOTD: ................................................DD
CONSENSUS: ..................................................
CONSENSUS_MOBI: ..................................................