A0A1B0GVY4 SIM31_HUMAN

Gene name: SMIM31
Protein name: Small integral membrane protein 31

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y2X3 NOP58 0.9 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
2 O75264 SMIM24 0.87251
3 P23921 RRM1 0.86656 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
4 P25789 PSMA4 0.80512 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
5 Q9P243 ZFAT 0.77672 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
6 Q8TBF4 ZCRB1 0.77128 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
7 Q06323 PSME1 0.77126 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 Q8NE71 ABCF1 0.76128 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
response to stress GO:0006950
...
9 Q5CZ79 ANKRD20A8P 0.76111
10 Q58FG0 HSP90AA5P 0.76064 protein folding GO:0006457

                                           20                  40                  60         
AA:                      MELPYTNLEMAFILLAFVIFSLFTLASIYTTPDDSNEEEEHEKKGREKKRKKSEKKKNCSEEEHRIEAVEL
STMI:                           MMMMMMMMMMMMMMMMMMMMM                                           
DO_DISOPRED3:            D....................................DDDDDDDDDDDDDDDDDDDDDDDD..........
DO_IUPRED2A:             ...............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
DO_SPOTD:                DDDDD..D.DDDDDD.DDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               D......                     ...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........
CONSENSUS_MOBI:          .......                     ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[E]:                                                    EEEEhEkkgrEkkrkksE                 
RICH_[K]:                                                          KKgreKKrKKseKKK              
RICH_[EK]:                                                   EEEEhEKKgrEKKrKKsEKKK              
RICH_fLPS_[E]:                                           ddsnEEEEhEkkgrEkkrkksE                 
RICH_fLPS_[KE]:                                              EEEEhEKKgrEKKrKKsEKKK              
RICH_fLPS_[K]:                                                eeeheKKgreKKrKKseKKK              
RICH_MOBI_[E]:                                               EEEEhEkkgrEkkrkksE                 
RICH_MOBI_[K]:                                                     KKgreKKrKKseKKK              
RICH_MOBI_[EK]:                                              EEEEhEKKgrEKKrKKsEKKK              
RICH_fLPS_MOBI_[E]:                                          EEEEhEkkgrE             EEEhriEavE 
RICH_fLPS_MOBI_[KE]:                                         EEEEhEKKgrEKKrKKsEKKK              
RICH_fLPS_MOBI_[K]:                                           eeeheKKgreKKrKKseKKK