P25789 PSA4_HUMAN
Gene name: PSMA4
Protein name: Proteasome subunit alpha type-4
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- nucleobase-containing compound catabolic process GO:0034655
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A0A1B0GVY4 | SMIM31 | 0.80512 | |
| 2 | Q96L12 | CALR3 | 0.7873 | cell differentiation GO:0030154 protein folding GO:0006457 reproduction GO:0000003 ... |
| 3 | P61254 | RPL26 | 0.77906 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | Q6ZW05 | PTCHD4 | 0.77604 | |
| 5 | P23921 | RRM1 | 0.77573 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 6 | O75264 | SMIM24 | 0.76787 | |
| 7 | O75027 | ABCB7 | 0.74379 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 8 | Q8IUX8 | EGFL6 | 0.74048 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 9 | Q9UI47 | CTNNA3 | 0.73866 | cell adhesion GO:0007155 circulatory system process GO:0003013 |
| 10 | Q93100 | PHKB | 0.73464 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 generation of precursor metabolites and energy GO:0006091 |
20 40 60 80 100 AA: MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQ STMI: DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDD................................................................................................. CONSENSUS: DDD................................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: YQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKT STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 260 AA: MDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK STMI: DO_DISOPRED3: ............................................DDDDDDDDDDDDDDDDD DO_IUPRED2A: .....................................DDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ..........................................DDDDDDDDDDDDDDDDDDD CONSENSUS: ..........................................DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ............................................................. RICH_[E]: EEakaErEkkEkEqkE RICH_[K]: KaereKKeKeqKeKdK RICH_[EK]: EEaKaErEKKEKEqKEKdK RICH_fLPS_[E]: EEakaErEkkEkEqkE RICH_fLPS_[KE]: EEaKaErEKKEKEqKEKdK RICH_fLPS_[K]: aKaereKKeKeqKeKdK