A0A1B0GX95 TVB74_HUMAN
Gene name: TRBV7-4
Protein name: T cell receptor beta variable 7-4
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96SQ5 | ZNF587 | 0.96446 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | A1IGU5 | ARHGEF37 | 0.96417 | |
| 3 | Q8TAU3 | ZNF417 | 0.96254 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | P20800 | EDN2 | 0.94238 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 5 | Q9Y3Z3 | SAMHD1 | 0.91776 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 6 | Q06546 | GABPA | 0.90496 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 7 | Q5RGS3 | FAM74A1 | 0.89833 | |
| 8 | Q7RTZ2 | USP17L1 | 0.89504 | catabolic process GO:0009056 cell death GO:0008219 cellular protein modification process GO:0006464 |
| 9 | Q86WG5 | SBF2 | 0.8938 | anatomical structure development GO:0048856 catabolic process GO:0009056 |
| 10 | Q9NRC8 | SIRT7 | 0.88235 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MGTRLLCWVVLGFLGTDHTGAGVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQGSEVLTYSQSDAQRDKSGRPSGRFSAERPERSVSTLKIQR STMI: SSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: ........................DDDD........................................DDDDD.DDDDDDDDDDDDDDDD....DDDD.. DO_SPOTD: D................................................................................................... CONSENSUS: ............................................................................... CONSENSUS_MOBI: .............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD... RICH_MOBI_[R]: RdksgRpsgRfsaeRpeR
AA: TEQGDSAVYLCASSL STMI: DO_DISOPRED3: ............... DO_IUPRED2A: ............... DO_SPOTD: ............... CONSENSUS: ............... CONSENSUS_MOBI: ...............