Q5RGS3 F74A1_HUMAN
Gene name: FAM74A1
Protein name: Protein FAM74A1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y6Z4 | KIF25-AS1 | 0.89833 | |
| 2 | Q96ID5 | IGSF21 | 0.89833 | |
| 3 | Q96SQ5 | ZNF587 | 0.8664 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | A1IGU5 | ARHGEF37 | 0.86614 | |
| 5 | Q8TAU3 | ZNF417 | 0.86468 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q9BTV5 | FSD1 | 0.84695 | cell cycle GO:0007049 cell division GO:0051301 cytoskeleton organization GO:0007010 ... |
| 7 | P20800 | EDN2 | 0.84656 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 8 | Q5TZK3 | FAM74A4 | 0.8394 | |
| 9 | Q9Y3Z3 | SAMHD1 | 0.82445 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 10 | Q06546 | GABPA | 0.81295 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MWRELRGCPGGDVETAQRLSQRRRGKSSEAVPEKTWRAQRMSQRRRGESSEAVPEKTWKELRNSETVPEKTWKQLRRCLQEDVERVQRLSLLLHLAVFLW STMI: MMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D.................................... DO_SPOTD: DDDDDDDDDDD......D.DDDDDDDDDDD........DDDDDDDDDDDDD................................................. CONSENSUS: .................DDDDDDDDDDDDD........DDDDDDDDDDDDD..................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................... RICH_MOBI_[R]: RelRgcpggdvetaqRlsqRRRgksseavpektwRaqRmsqRRRgesseavpektwkelR RICH_MOBI_[ER]: RRRgEssEavpEktwkElR RICH_MOBI_[GR]: RGcpGGdvetaqRlsqRRRG RICH_fLPS_MOBI_[R]: RaqRmsqRRR
120 AA: IIIAINFSNSGVKSQSSTYLPSGKILK STMI: MMMMMMMMM DO_DISOPRED3: ........................... DO_IUPRED2A: ........................... DO_SPOTD: ..........DDDDDDDDD..DDDDDD CONSENSUS: .................. CONSENSUS_MOBI: ..................