A0A2R8Y7G9 A0A2R8Y7G9_HUMAN
Protein name: Deleted.
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P10412 | H1-4 | 0.79689 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | P82914 | MRPS15 | 0.79346 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 3 | Q5TEC6 | H3-2 | 0.76966 | |
| 4 | O94811 | TPPP | 0.7599 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 5 | Q9NYX4 | CALY | 0.75817 | cellular component assembly GO:0022607 protein transport GO:0015031 protein-containing complex assembly GO:0065003 ... |
| 6 | Q96FV0 | LRRC46 | 0.74752 | |
| 7 | P16401 | H1-5 | 0.73378 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 8 | P16402 | H1-3 | 0.73256 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | P50914 | RPL14 | 0.71868 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | Q9UNZ5 | C19orf53 | 0.71186 |
20 40 60 80 100 AA: MARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAY STMI: DO_DISOPRED3: D......D.......DDDDDDDDDDDDDDDDD.................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDD................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... RICH_[AK]: KqtArKAtAwqAprKplAtKAAgK RICH_[AP]: AwqAPrkPlAtkAAgkrAPP RICH_[AT]: TkqTArkATAwqAprkplAT RICH_[A]: ArtkqtArkAtAwqAprkplAtkAAgkrA RICH_[K]: KqtarKatawqaprKplatK RICH_[T]: TkqTarkaTawqaprkplaT RICH_[KP]: PlatKaagKraPPtggiKKP RICH_fLPS_[A]: ArkAtAwqAprkplAtkAAgkrA RICH_MOBI_[AK]: KqtArKAtAwqAprKplAtKAAgK RICH_MOBI_[AT]: TkqTArkATAwqAprkplAT RICH_MOBI_[A]: ArtkqtArkAtAwqAprkplAtkAAgkrA RICH_MOBI_[K]: KqtarKatawqaprKplatK RICH_MOBI_[T]: TkqTarkaTawqaprkplaT RICH_fLPS_MOBI_[A]: ArkAtAwqAprkplAtkAAgkrA
120 AA: LVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREGP STMI: DO_DISOPRED3: ..................................DD DO_IUPRED2A: .........................D..DDDDDDDD DO_SPOTD: ................................DDDD CONSENSUS: ................................DDDD CONSENSUS_MOBI: ....................................