Q5TEC6 H3PS2_HUMAN
Gene name: H3-2
Protein name: Histone HIST2H3PS2
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P82914 | MRPS15 | 0.86499 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 2 | Q9UNZ5 | C19orf53 | 0.84743 | |
| 3 | P10412 | H1-4 | 0.84239 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q6NXT2 | H3-5 | 0.84167 | growth GO:0040007 |
| 5 | P16402 | H1-3 | 0.80253 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | A0A2R8Y7G9 | n/a | 0.76966 | |
| 7 | Q9BWS9 | CHID1 | 0.75432 | carbohydrate metabolic process GO:0005975 immune system process GO:0002376 response to stress GO:0006950 ... |
| 8 | P50914 | RPL14 | 0.74629 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | P47914 | RPL29 | 0.74232 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 10 | Q9NQS5 | GPR84 | 0.73504 | immune system process GO:0002376 signal transduction GO:0007165 transport GO:0006810 ... |
20 40 60 80 100 AA: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQEFKTDLRFQSSAVMALQEAREAY STMI: DO_DISOPRED3: D...............DDD.D.DDDDDDDD...................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD..DDD................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS_MOBI: D........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... RICH_[AK]: ArKstggKAprKqlAtKAArKsApA RICH_[A]: AprkqlAtkAArksApA RICH_[K]: KqtarKstggKaprKqlatKaarK RICH_[T]: TkqTarksTggkaprkqlaT RICH_[KT]: TKqTarKsTggKaprKqlaT RICH_fLPS_[A]: AtkAArksApA RICH_MOBI_[AK]: KstggKAprKqlAtKAArKsApA RICH_MOBI_[A]: AprkqlAtkAArksApA RICH_MOBI_[K]: KstggKaprKqlatKaarK RICH_fLPS_MOBI_[A]: AtkAArksApA
120 AA: LVGLFEDTNLCAIHAKRVTIMPKDIQLVSRIRGERA STMI: DO_DISOPRED3: ...................................D DO_IUPRED2A: .................................... DO_SPOTD: .................................DDD CONSENSUS: ...................................D CONSENSUS_MOBI: ....................................