A1L168 CT202_HUMAN

Gene name: C20orf202
Protein name: Uncharacterized protein C20orf202

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A8MQB3 LINC02693 0.9048
2 O95922 TTLL1 0.89585 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
3 Q9BTV5 FSD1 0.88496 cell cycle GO:0007049
cell division GO:0051301
cytoskeleton organization GO:0007010
...
4 P32239 CCKBR 0.87954 anatomical structure development GO:0048856
cell population proliferation GO:0008283
homeostatic process GO:0042592
...
5 Q8N142 ADSS1 0.86941 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
6 P28062 PSMB8 0.86368 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
7 Q96PD7 DGAT2 0.85058 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
8 Q9Y5X5 NPFFR2 0.84981 cellular protein modification process GO:0006464
signal transduction GO:0007165
9 Q99832 CCT7 0.84233 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
10 Q86SX3 TEDC1 0.8357 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHLHSVLEELRADSAHWEDARSSGGTSPIRARAGSEGRGCQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDD..DD....D.............................................................................
DO_IUPRED2A:             DDDD....DDDDDDDDDDDDDDDDDDDDDDDDDD..DDD.................................DDDDDDDDDDDDDDDDDDDDDDDDD.D.
DO_SPOTD:                DDDDDDDDDDDDDD.DDDDDDDDDDDDDD.............................................D.DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................DDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS_MOBI:          ........................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                  KsKipraqnqvsvKvtpK                                                                                
RICH_[R]:                                                                                               RssggtspiRaRagsegR   
RICH_[GR]:                                                                                              RssGGtspiRaRaGseGRG  
RICH_MOBI_[R]:                                                                                          RssggtspiRaRagsegR   
RICH_MOBI_[GR]:                                                                                         RssGGtspiRaRaGseGRG  

                                          120                  
AA:                      PVCSRGLAQLLRGEDSRRSSLP
STMI:                                          
DO_DISOPRED3:            ............DDDDDDDDDD
DO_IUPRED2A:             .........D...DDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .........DDDDDDDDDDDDD
CONSENSUS_MOBI:          D.....................