P28062 PSB8_HUMAN
Gene name: PSMB8
Protein name: Proteasome subunit beta type-8
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- nucleobase-containing compound catabolic process GO:0034655
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | O95922 | TTLL1 | 0.99136 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
2 | A8MQB3 | LINC02693 | 0.95543 | |
3 | Q99832 | CCT7 | 0.92249 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
4 | Q8N142 | ADSS1 | 0.91326 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
5 | O75462 | CRLF1 | 0.90756 |
anatomical structure development
GO:0048856 cell death GO:0008219 cell population proliferation GO:0008283 ... |
6 | Q8TCG5 | CPT1C | 0.89337 |
catabolic process
GO:0009056 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
7 | O43323 | DHH | 0.88852 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
8 | Q9BQ65 | USB1 | 0.87586 |
cellular nitrogen compound metabolic process
GO:0034641 |
9 | P17152 | TMEM11 | 0.87525 |
membrane organization
GO:0061024 |
10 | A1L168 | C20orf202 | 0.86368 |
20 40 60 80 100
AA: MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISA
STMI:
DO_DISOPRED3: .......D...DDDDDDDDDDDDDDDDDDDDDDDD.................................................................
DO_IUPRED2A: .............DDDDDDDDDDDD....DDDD.....................D.........D...................................
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
CONSENSUS: .......DDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................
CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................
RICH_[R]: RgqRpesalpvagsgRR
RICH_[GR]: GapRGqRpesalpvaGsGRR
RICH_MOBI_[R]: RgqRpesalpvagsgRR
RICH_MOBI_[GR]: GapRGqRpesalpvaGsGRR
120 140 160 180 200
AA: LRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFST
STMI:
DO_DISOPRED3: ....................................................................................................
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: ....................................................................................................
CONSENSUS: ....................................................................................................
CONSENSUS_MOBI: ....................................................................................................
220 240 260
AA: GSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
STMI:
DO_DISOPRED3: .........................................................................DDD
DO_IUPRED2A: ...................................................................D.D......
DO_SPOTD: .........................................................................DDD
CONSENSUS: .........................................................................DDD
CONSENSUS_MOBI: .........................................................................DDD