A1L1A6 IGS23_HUMAN
Gene name: IGSF23
Protein name: Immunoglobulin superfamily member 23
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BUX1 | CHAC1 | 0.96607 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | Q86UT5 | PDZD3 | 0.87725 | signal transduction GO:0007165 transport GO:0006810 |
| 3 | Q96N19 | GPR137 | 0.77419 | catabolic process GO:0009056 homeostatic process GO:0042592 signal transduction GO:0007165 |
| 4 | Q8N423 | LILRB2 | 0.75699 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | Q6EMK4 | VASN | 0.74551 | anatomical structure development GO:0048856 cell differentiation GO:0030154 response to stress GO:0006950 ... |
| 6 | Q9HA65 | TBC1D17 | 0.74188 | catabolic process GO:0009056 protein transport GO:0015031 transport GO:0006810 ... |
| 7 | P00748 | F12 | 0.71169 | immune system process GO:0002376 protein maturation GO:0051604 response to stress GO:0006950 |
| 8 | O00330 | PDHX | 0.71154 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 9 | A0PG75 | PLSCR5 | 0.70636 | membrane organization GO:0061024 plasma membrane organization GO:0007009 transport GO:0006810 |
| 10 | P50281 | MMP14 | 0.70632 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MRAKPQSPLPRNPVPAWSPPTTTTDPMLEKDAAGGDFPANLVLQLMPLKTFPAAIRGVIQSELNYSVILQWVVTMDPEPVLSWTFSGVPCGMGEKLFIRR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... RICH_[PT]: PqsPlPrnPvPawsPPTTTTdP RICH_[P]: PqsPlPrnPvPawsPPttttdP RICH_MOBI_[PT]: PqsPlPrnPvPawsPPTTTTdP RICH_MOBI_[P]: PqsPlPrnPvPawsPPttttdP
120 140 160 180 AA: LSCEQLGTYMCIATNSKKQLVSEPVTISLPKPIMQPTEAEPMEPDPTLSLSGGSAIGLLAAGILGAGALIAGMCFIIIQSLRTDRQRIGICS STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .....................................................................................DDDDDDD DO_IUPRED2A: ................................DDDDDDDDDDDDDDD............................................. DO_SPOTD: ..................................................................................DDDDDDDDDD CONSENSUS: ......................................................... .......DDDDDDD CONSENSUS_MOBI: ......................................................... ..............