Q9BUX1 CHAC1_HUMAN
Gene name: CHAC1
Protein name: Glutathione-specific gamma-glutamylcyclotransferase 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- protein maturation GO:0051604
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A1L1A6 | IGSF23 | 0.96607 | |
| 2 | Q16613 | AANAT | 0.86192 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 3 | A0PG75 | PLSCR5 | 0.86181 | membrane organization GO:0061024 plasma membrane organization GO:0007009 transport GO:0006810 |
| 4 | Q96QK8 | SMIM14 | 0.86125 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 5 | P50281 | MMP14 | 0.85669 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 6 | O75880 | SCO1 | 0.85538 | catabolic process GO:0009056 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 7 | Q8IY18 | SMC5 | 0.8545 | cell cycle GO:0007049 cell division GO:0051301 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q14626 | IL11RA | 0.85417 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 signal transduction GO:0007165 |
| 9 | Q86UT5 | PDZD3 | 0.83301 | signal transduction GO:0007165 transport GO:0006810 |
| 10 | Q9BQI0 | AIF1L | 0.82183 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
20 40 60 80 100 AA: MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQ STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ RICH_[PT]: TPPTsqsPTP RICH_[P]: PntPPtsqsPtPsaqfP RICH_MOBI_[PT]: TPPTsqsPTP RICH_MOBI_[P]: PntPPtsqsPtPsaqfP
120 140 160 180 200 AA: GEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAA STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .......................................D.............D.............................................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: IVDAVGTMLPCFCPTEQALALV STMI: DO_DISOPRED3: ....................DD DO_IUPRED2A: ...................... DO_SPOTD: ............DDDDDDDDDD CONSENSUS: ....................DD CONSENSUS_MOBI: ......................